Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G139535-GRMZM2G002131
Species:maize
Duplication type:WGD
Function (paralog1):heat shock factor protein 4
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGEAAAAVAASKRGGGPAPFLTKTHQMVEERGTDEVISWAEQGRSFVVWKPVELARDLLP
LHFKHCNFSSFVRQLNTYLCYVVDERAFQAATVPSSKEYMRGFRKVVPDRWEFANDNFRR
GEQGLLSGIRRRKSTALQMSKSGSGGSGGVNATFPPPLPPPPPASATTSGVHERSSSSAS
SPPRAPDLASENEQLKKDNHTLSAELAQARRHCEELLGFLSRFLDVRQLDLRLLMQEDVR
AGASDDGAQRRAHAVASQLERGGGEEGKSVKLFGVLLKDAARKRGRCEEAAASERPIKMI
RVGEPWVGVPSSGPGRCGGEN*

MVEEGATAAASRSGPAPFLSKTHQMVEERGTDEVISWAEQGRSFVVWKPVELARDLLPLH
FKHCNFSSFVRQLNTYGFRKVVPDRWEFANENFRRGEQGLLSGIRRRKSTTPQPSKYGGG
SVVNTAFPPPLPLPPPASVTTSGGGGAGGAGNERSSSSASSPPRTDDLTSENEQLKKDNR
TLSTELAQARRHCEELLGFLSRFLDVRQLDLGLLMQEDVRAGAGDDAAPRRAMVSQLERG
GEEGKSVKLFGVLLTDAARKRARCEEAAASERPIKMIRIGEPWIGVPSSGPGRCGGGN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):966Length 2 (bp):897Length divergence:-0.037
MFE 1 (kcal):-490.3MFE 2 (kcal):-460.5MFE divergence-0.031