Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G139765-GRMZM2G300924
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0266472367256
Log2 mRNA fold difference:1.2986256057192
Log2 TE fold difference:0
Sequences
Protein sequence

MEPMGRDGGGGHGRGWKGKGVSSGSAAGRQLAPVLEDAPAAALLRPLKKIRSPDRRLNRS
LSALSSSAPPSPDSSSVSNPMSPPSTRHIFPFAYDPAPAASTSTAASPRLLPLLQYGSVF
QQPLPPQQPLQHQQMISFGSRQQQFGAAAAPLFPPQLVAPPEVQQQMLLLRYWSEALNLS
PRGFRAGAGAGAVPPALYQQLLRAPKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTA
EDAAMAYDREAFKLRGENAKLNFPDLFLGKGRVGGSGRTSASAAVSCSSSSSSAPPTPDE
NHAKQAQRHDGEQPCNSEAKPLFPEAEQPNNLEHEPNSQLQSADHHGGDGSTVMFQPSVA
SSGMWGPAEEAWFSAWGPGSSVWDYDMDNAHGLFLQSRFASEAASMDYVSSMPEAPATPA
AGTAVASAASLSSPPPLPLPRSPTYRWKD*

MEPVGGDGGGGRGRGRGRSWKGKGVSSGSAAGRQLAPVLEDAPAAALLRPLKKIRSPDRR
LNRSLSSLSPAPPSPDSSSAFNPTPLPSARQIFLAPEASTAGSPRLLPLLQYSSEFQRPM
TPPPPDQQQLQQMISFGSSQQPRQEFVAAAAATPLFPPQLVAPEVQQQMLLRYWSEALNL
SPRGFRGGAVPLPPARLYQQLLLRASSGPPKLYRGVRQRHWGKWVAEIRLPRNRTRLWLG
TFDTAEDAAMAYDREAFKLRGDNARLNFPDLFLGKGRVGGSGRTSAAASCSSSAPPTPDD
SHMKQAAQQQQRVRDGEQPCSGEAKPLLPETETERADNSEPKPNPELQSADHQGDGTTAM
FQPSGGVWGPADEAWFSAWGPGSSVWDYDMDNAHGLFLQSRFASEATSMDYVPSTPEVPA
VGTAVASLSPPPPPPRSPTYMKEKD*

Other information
Ka divergence:0.286952KaKs divergence:-0.104305
GC content 1 (%):68GC content 2 (%):69GC content divergence:0.007
Length 1 (bp):1350Length 2 (bp):1338Length divergence:-0.004
MFE 1 (kcal):-693MFE 2 (kcal):-705.17MFE divergence0.009