Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G139803-GRMZM2G157458
Species:maize
Duplication type:WGD
Function (paralog1):Ferredoxin-thioredoxin reductase, variable chain (FTR-V)(Ferredoxin-thioredoxin reductase subunit A)(FTR-A)
Function (paralog2):ferredoxin-thioredoxin reductase, variable chain

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.23898410222548
Log2 mRNA fold difference:-0.75788325344996
Log2 TE fold difference:0.57063083498423
Sequences
Protein sequence

MATATASVAPPSTSTSSVLLHRRLPSPAPAPASAAFPRLSGPAPPPRRARLLLRVALTNE
VASDDVAAEEAAAAPKIGRRVRVTAPLRVYHVLKAPDLDIQGMEGVVKQYVCVWKGKRVT
ANFPFKVEFELAVEGQPKPVRFFAHLREDEFEFVDGE*

MATATAAVAPPSTSTSSVLLRRRLPSPAPASASAAFPRLPGPPPPPPRRARLLLLQVALT
SEVASDDVAAEEAAAAPKIGRRVRVTAPLRVHHVIKAPDLDVQGMEGVVKQYVGVWKGKR
VTANLPFKVEVQLAVEGQPKPVRFFVHLREDEFEFVDGE*

Other information
Ka divergence:0.163054KaKs divergence:-0.999838
GC content 1 (%):73GC content 2 (%):74GC content divergence:0.007
Length 1 (bp):474Length 2 (bp):480Length divergence:0.006
MFE 1 (kcal):-225.4MFE 2 (kcal):-226.6MFE divergence0.003