Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G139822-GRMZM2G065971
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100274272

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRPHAVGTGGGGVGRRKAGAAAAAASREWMVVPASGPARVEEAGKHAVMARTGLPARDLR
VLDPLLSYPSTILGRERAIVVNLERVKALITATEVLLPNTKDPAFARFVRDLQTRVLASS
SDQAAEFTDMEGESSNVASPFPLPSASKGHEMEMTKKTTAVVPEMTSSSSMPNLAIAKDG
NTNVLPFEFRALEVCLESACRSLEDETSTLEQEAYPALDELTSKISTLNLERVRQIKSRL
VAISGRVQKVRDELEHLLDDEMDMAEMYLTEKLTQQEISEASSRAEVDDPSQTEEDRDED
YRSEPDGSNDSFIGYKPNIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDD
KQNQLLQMGVMLSTATVVITAGVAVVGLFGMNIGISLYADPTTEEETRAANRKFWETTFG
TVAGCVILYIIAMGWGKRSGLLQ*

MRPHAVGMGGGGVGRRKAGAAAAAASREWLVVPASGPARVEEAGKHAVMARTGLPARDLR
VLDPLLSYPSTILGRERAIVVNLERVKALITAAEVLLPNTKDPAFARFVRDLQTRVLASS
SDQAAELTDMEGESPIVASPFPVPSSSKGHEMEMTKKTAAVVPEMTSSSSMPNLAVAKDG
NTKVLPFEFRALEVCLESACRSLEEETSTLELEAYPALDELTSKISTLNLERVRQIKSRL
VAISGRVQKVRDELEHLLDDEMDMAEMYLTEKLTQQEISEASSRAEVDDASLTEDDRDED
YRSEPDGSNGSVIGYKPNIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLDD
KQNQLLQMGVMLSTATVVITAGVAVVGLFGMNIGISLYADPTTEEETRAANRKFWETTFG
TVAGCVILYIIAMGWGKRSGLLQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):1332Length 2 (bp):1332Length divergence:0
MFE 1 (kcal):-474.14MFE 2 (kcal):-496.66MFE divergence0.023