Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G139855-GRMZM2G447195
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278333 (LOC100278333), mRNA
Function (paralog2):hypothetical protein LOC100276558

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.52953547076382
Log2 mRNA fold difference:1.4370531378808
Log2 TE fold difference:-1.984536256431
Sequences
Protein sequence

MQQHSQPPPPPPGRLVPSRRLLSQAKTSLSLSSQILLRNPPLRSVMQAFARLSSAASRKV
IAGVSSATTRSCYRTSRGLAHAASLPAQEPPPKGQKRITKQERRTRIMEFIENYRASNDG
KFPTIKNIRQQVGGSHYTAREIIQEMEYNNAKLPLSNAKAAPLQGTVEVIEHSMPKDEAI
VVESHGILEVSEHSMTKDGDEAAQIQGTIEVSEHSFPKDECKLAQCQGPFRFPEHSRPKD
DSGNVAKHDMDTPETCKTADFPALSDQTESEIMEDLTDKPDPGNQQREIEAIKFNLKHYE
KPLNANDSNAKTHAREDNPKLEESANTGLLGSLKSFAYGIRNFWKNL*

MQASARLSYSVASRKVIAGVSIAPPRSCYRTSRGKAHAAPLPAQEPPPKGLKRITKQERR
VRIVEFVENYRASNEGKFPTVKNICQQIGGGYYAVRELLQEMKYNHAKLPLGNAKAAPLQ
TTVEVTEHPMPKDEARVVESQGILEVSEHSMAKDDAEVAQPQGTAEVFEHFLSKDEGKVA
QCQGTFHFPEHSRPKDDSGKTARHDMDTSETCKTADAPALSDLTENEGILSDQTESEDKP
DPGNQQREIEANKFDLKNFEKNLNANDSNASDQSGSDTVNEAKTHASSFVMINYLDLARG
LLLPLSVYNWLIQAVEDEFSLRLR*

Other information
Ka divergence:0.213332KaKs divergence:-0.440307
GC content 1 (%):49GC content 2 (%):45GC content divergence:-0.043
Length 1 (bp):1044Length 2 (bp):975Length divergence:-0.034
MFE 1 (kcal):-329.05MFE 2 (kcal):-292.33MFE divergence-0.059