Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140288-GRMZM2G044126
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383928
Function (paralog2):histone acetyl transferase MYST family 101

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEELPVPVDHPIGETAGRPLHDAGRCKRNTPMHVPAPHLLPAPPKPHYHAALRFTVAASA
APASPRKAVIVGGGLAGLAAATHLTSLSVPFTLVEASDRLGGRVATDVVDGYRLDRGFQI
FLTAYPECRRLLDFPELRLRPFYPGALVFVGAGEPFYLLSDPFRLPLRSLSAVFSPVGTL
TDKVLVGLTRLRAAATPDDVILSAPETTTGEHLARLGFSPSIVERFLRPFLAGIFFDPAL
DTSSRLFELVFKRLALGDNALPEDGIGAIAAQLAARLPAGSVRLNTRAVGIDQSGVTLDT
GETVAGGLGVIVAVEQPQAEKLLPQLPAQGKAKKSERSTVCLYFSTDRAPVQDPILLLNG
SGKGIVNNMFFVTNVAPSYAPAGKVLVSVSLVGSFADREDADLADEVVRELGGWFGDGEV
ASWTHLSTYRIGFAQPDQTPPTTPAGRDPRVGDGLYVCGDHWCSATFDGALVPQSHNEFR
TGTSKEQIRKPKGPIQPRRPNPESLTVTSDPLRLRRRMGSMEASTAPENGSAAGGGAGNG
AGAASNGGGVERRLRSSAAPASWAAQLPLEVGTRVMCRWRDQKLHPVKVIERRKGSASSS
PADYEYYVHYTEFNRRLDEWVKLEQLDLATVETDVDEKVEDKATSLKMTRHQKRKIDETH
VEQGHEELDAASLREHEEFTKVKNIAKIELGRYEIDTWYFSPFPPEYNDCPKLFFCEFCL
NFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHK
TLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIA
FSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLEILKKHKGNISIKELSDMTAIKAD
DILSTLQSLDLIQYRKGQHVICADPKVLDRHLKAAGRGGLDVDVSKLIWTPYKEQG*

MGSMEASTAPENGSSAAGGGAGGTACNGAGAASNGGGMERRLRSSAASASWAAHLPLEVG
TRVMCRWRDQKLHPVKVIERRKGSACSSPADYEYYVHYTEFNRRLDEWVKLDQLDLDTVE
TVVDEKVEDKATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIAKIELGR
YEIDTWYFSPFPPEYNDCPKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTL
SMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEK
HSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWT
RVLLEILKKHKGNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHL
KAAGRGGLDVDVSKLIWTPYKEQG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):50GC content divergence:-0.083
Length 1 (bp):2871Length 2 (bp):1335Length divergence:-0.365
MFE 1 (kcal):-1206.84MFE 2 (kcal):-473.31MFE divergence-0.437