Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140328-GRMZM2G391042
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.47890697175832
Log2 mRNA fold difference:-0.4250302583972
Log2 TE fold difference:0.1163592605373
Sequences
Protein sequence

MESSSSGGGLARRRSSGGWGSFSGDTDPFDIPAKGAPLERLRKWRQAALVLNASRRFRYT
LDLKKEEQNEEIRRKIRAKAYVITAAFRFKEAGRVHVRSEETKVPIADGALGFGIKEDEI
TALTRDHNYSGLQQYGGVSGVAHMLKTDSEKGISGDDSDLIARKNTFGSNTYPRKKGRSF
LAFVWDACKDLTLIILMVAAAVSLALGITTEGIKEGWYDGASIAFAVLLVVFVTAISDYK
QSLQFQNLNEEKQNIRLEVVRGGRRITVSIYDLVVGDVVPLKIGDQVPADGILINGHSLS
IDESSMTGESKIVHKDQKSPFLMSGCKVADGYGTMLVTAVGVNTEWGLLMASISEDSGEE
TPLQVRLNGVATFIGMVGLSVALAVLVVLLARYFTGHTYNPDGSVQYVKGKMGVGQTIRG
VVRIFTVAVTIVVVAVPEGLPLAVTLTLAFSMRKMMKDKALVRRLSACETMGSATTICSD
KTGTLTLNQMTVVEAYFGGKKMDSPDNAQMLSADVTSLIVEGIAQNTSGSIFEPEGGQEP
EVTGSPTEKAILSWGLKLGMKFNETRLKSSILHVFPFNSEKKRGGVAVHLDGPEVHIHWK
GAAEIILDSCTSWLDTDGSKHSMTPEKIAEFKKFIEDMAVASLRCVAFAYITHEMDDVPN
EDQRAEWKLPEDNLIMLGIVGIKDPCRPGVRDSVRLCQAAGIKVRMVTGDNLQTARAIAL
ECGILDDPNVLEPVIIEGKAFRVLSDLEREEAAEKISVMGRSSPNDKLLLVKALRARGHV
VAVTGDGTNDAPALHEADIGLSMGIQGTEVAKESSDIIILDDNFASVVRVVRWGRSVYAN
IQKFIQFQLTVNVAALIINVVAAVSSGNVPLNAVQLLWVNLIMDTLGALALATEPPTNHL
MERPPVGRREPLITNIMWRNLIIMALFQVSVLLTLNFKGISLLQLKNDDPAHADKVKNTF
IFNTFVLCQVFNEFNSRKPDELNIFKGISGNHLFIGIIAITVVLQALIVEFLGKFASTVR
LSWQLWLVSIGLAFFGWPLAFVGKLIPVPKRPLGEFFACCCICKGSKQAPDDATSNDKED
NKPEP*

MESLSSGGELARRQSSGGGSSGWGSFSGDADPFDIPAKGAPLERLRKWRQAALVLNASRR
FRYTLDLKKEEQKEEIRRKIRAQAHVIRAAFRFKEAGRIHVQSEETKVPCADGALGFGIK
EDQITALTRDHNYSGLQQYGGVSGVAHMLKTDTQKGISGDDSDLLARKNAFGSNTYPRKK
GRSFLAFVWDACKDLTLIILMVAAAVSLALGITTEGIKEGWYDGASIAFAVLLVVFVTAI
SDYKQSLQFQNLNEEKQNIRLEVVRGGRRITVSIYDLVVGDVVPLKIGDQVPTDGILISG
HSLSIDESSMTGESKIVHKDQKSPFLMSGCKVADGYGTMLVTAVGINTEWGLLMASISED
SGEETPLQVRLNGVATFIGMVGLSVALAVLVVLLARYFTGHTYNPDGSVQYVKGNMGVGQ
TIRGIVKIFTVAVTIVVVAVPEGLPLAVTLTLAFSMRKMMKDKALVRRLSACETMGSATT
ICSDKTGTLTLNQMTVVEAYFGGKKMDSPDNAQMLSADVTSLIVEGIAQNTSGSIFEPEQ
GGQEPEVTGSPTEKAILSWGLKLGMKFSETRSKSSILHVFPFNSEKKRGGVAVYLAGSEV
HIHWKGAAEIILDSCTSWVDTGGSKHSMTPEKVAEFKKFIEDMAAASLRCVAFAYRTHEM
DDVPDEDRREEWQLPEDNLIMLGIVGIKDPCRPGVRDSVRLCQAAGIKVRMVTGDNLQTA
RAIALECGILDDPNVSEPVIIEGKTFRALSDLEREDAAEKISVMGRSSPNDKLLLVKALR
ARGHVVAVTGDGTNDAPALHEADIGLSMGIQGTEVAKESSDIIILDDNFASVVRVVRWGR
SVYANIQKFIQFQLTVNVAALIINVVAAVSSGNVPLNAVQLLWVNLIMDTLGALALATEP
PTNHLMERPPVGRREPLVTNIMWRNLIIMATFQVSVLLSLNFKGISLLQLKNDDPAHADK
VKNTFIFNTFVLCQVFNEFNSRKPDELNIFKGISGNHLFIGIIVITVILQALIVEFLGKF
ASTVRLSWQLWLVSIGLAFFSWPLAFVGKLIPIPKRPLGEFFACCCNCKGSKQGPDDATS
NGKEDNKLEP*

Other information
Ka divergence:0.0480017KaKs divergence:-0.0695222
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):3258Length 2 (bp):3273Length divergence:0.002
MFE 1 (kcal):-1049.09MFE 2 (kcal):-1079.48MFE divergence0.014