Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140342-GRMZM2G161291
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191444
Function (paralog2):hypothetical protein LOC100382394

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.074722622878725
Log2 mRNA fold difference:-0.67302320831061
Log2 TE fold difference:0.6502247649053
Sequences
Protein sequence

MAVHLLLAVAVALLLCPGDASVHDYRGLSFANKGNAFILHAGSEGLYAASHANTTAEDDE
DTAAVADAFIRFDKVTFRRPEDTNDSVKETSSAKVHILVFEVEDREMIGGSAYGGQKAIC
CSSDLAKLGACKEGSVIYRPSQVNPGWPKLFVASFEGSDLIATLPSRTIQITKTGMYNMY
FIHCDPSLASLEIEGKTIWKNPTGYLPGRMAPLKNFFGLMSFAFVVLGIYWFYQYMKSWK
EVLPLQNCITLVITLGMLEMALWYFEYAEFNETGVRPKGITFWAVTFGTVKRTAAEVIVL
IVSMGYGVVAPTLGGLTSKVVMLGGTFFLATEILELVENLGAVNDLSGKARLFLVYPVAI
LDAAFVVWIFISLAKTIGKLQARRLMAKLDIYRKFATALIVSVLVSVGWIGYEIYSKSTD
VFNERWQHAWIIPAFWHVLSFLLLCVICYLWAPSQNSMRFSYDASEFFDRKDNLSLIRPA
TSASKNGWSLSSAPEAKATKDVNTVADFEGDDEENKRE*

MAGRFLLVVAVALLLRPGDASVHEYRGLSFANKGNAFILHAGSEGLYAASHANTTAEDAA
AVAEALIRFDKITFRRSEDTNNSVKETSSAKVQVLIFEIEDREMIGGSAYGGQKAICCTS
DLAKLGACTEGSVIYRPSQVNPGWPKLFVASFDGSDLIATLPSRTIPITKTGIYNMYFIH
CDPSLASLEIEGKTIWKNPTGYLPGRMAPLKNFFGLMSFAFVVLGIYWFYQYMKSWREVL
PLQNCITLVITLGMFEMALWYFEYAEFNETGVRPKGITFWAVTFGTVKRTAAEVIVLIVS
MGYGVVTPTLGGLTSKVVMLGGTFFLATEILELVENLGAVNDLSGKARLFLVYPVAILDA
AFVIWIFISLAKTIGKLQARRLMAKLDIYRKFATALIISVLVSVGWIGYEIYSKSTDVFN
ERWQHAWIIPAFWHVLSFLLLCVICYLWAPSQNSMRFSYDASEFFDRKDNISLIRPAPSA
SKNGWNLSSTPEPKATKDVNTVADFEGDDEENKRE*

Other information
Ka divergence:-0.212112KaKs divergence:0.104227
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1557Length 2 (bp):1548Length divergence:-0.003
MFE 1 (kcal):-505MFE 2 (kcal):-480.54MFE divergence-0.025