Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140352-GRMZM2G019251
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193488
Function (paralog2):hypothetical protein LOC100278324

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSGGLDMSLDDLIKQSKSRPKDSPASLSGPARRAPHPARAAPYPPAAPKARAAADSPYGV
YSKHIAAIAPPPLAKARSLETGTKLHISNLDSGVTIEDVQELFSEVGELKRYSMNYDKDG
RSKGTVEVVFARKVDALDAIKRYNGVLLDGKPMNLELIGNNVEPPPMPPVIHSRPLQNYN
DIHSSMPQSQRGGQRRVPQGNGRGGRSSQSSGGRGQGKGRGQDRNRTTISAADLDAELDK
YHAAAVKEE*

MSSGLDMSLDDLIKQSKSRPKANPASSSGPARRAHPARAAPYPPVAPKARATADSPYGVY
SEQIAAIAAAAPLPAKARSLETGMKLHISNLDSGVTVEDVQELFSEVGELKRYSMNYDKD
GRSKGTAEVVFARKVDALDAIKRYNGVLLDGKPMNLELIGNNVEPPPLPPLIHNRPLQNY
NDIHSSVLQSQRNGQRRAPQVNGRGGRSSQTSGGRGQGRGRGQDRNRTPISASDLDAELD
KYHAAAAKEE*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):57GC content divergence:0
Length 1 (bp):750Length 2 (bp):753Length divergence:0.002
MFE 1 (kcal):-279.3MFE 2 (kcal):-270.9MFE divergence-0.015