Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140394-GRMZM2G050885
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383469
Function (paralog2):hypothetical protein LOC100280346

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAGVDAARYAHSPAHHAVAARDHAALRRVLDALPRARRPEEIRTEADSVAEEARAEAVSA
VIDRRDVPGRETPLHLAVRLCDPTAAEMLMAAGADWSLQNEQGWSALQEAICTREEALAR
VIVRHYQPLAWAKWCRRLPRVVAAMRRMRDFYMEITFHFESSVIPFISRIAPSDTYRVWK
RGSNLRADMTLAGFDGFKIQRSDQTILFLGEGSEDGKVPPGSLCMINHKDKEIMNALEGA
GTPASDAEVQQEVAAMSQTNIFRPGIDVTQALLLPQLTWRRQERTEAVGPWKAKVYEMNH
VVVSVKSRRVPGAMTDEEFFSSCNDNDIESEGFDDVLTEEEKKQLEAALKMDSPDAGGED
QSDSFAGPRHSCFEPREREVPIEDMSVSGNGEGKHDKKGWFSNWGKRSQVSKSEGVKKMA
SPRNSLCVDDKVSDLVIESPSNVQTRPGRHSVDVVRPDDNRRIRERDSRRHVASAENGHR
RKEGSKESEYKKGLRPVLWLSPNFPLRTEELLPLLDILANKVKAIRRLRDLLTTKLPPGT
FPVKVAIPVVPTIRVLVTFTKFEELQPLDEFTTPPSSPDNSKSPAVQPSSSSWIQWIKAP
YLQNLSTAPGPSSRVEDIQDPFAIPSNYVWTTPEEKKKKTQENKNKSKKGRSGA*

MAGVDVARHAHSPAHHAVAARDHVALRRVLEALPPARRPEEIRTEADSVAEEARAEAVSA
VIDRRDVPGRETPLHLAVRLCDATATEMLMAAGADWSLQNEQGWSALQEAICAREEALAR
VIVRHYQPLAWAKWCRRLPRVVAAMRRMRDFYMEITFHFESSVIPFISRVAPSDTYRVWK
RGANLRADMTLAGFDGFKIQRSDQTILFLGEGSEDGKVPPGSLCMINHKDKEIMNALEGA
GAPASEAEVQQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQERTEAVGPWKAKVYDMNH
VLVSVKSRRVPGAMTDEEFFSSSNDNDTESEGFDDVLTEEEKKQLEAALKMDSPDAGGED
QSDSFAGPRHSCFEPREREIPIEGMSVSGNVESKHDKKGWFSNWGKRAQVSKPERVKKMA
PPRSSLCVDEKVSDLLFESPSNAQTRPGRHSVDVVRADDNRRIRERDSRRYVPSAENGHR
RKEGSKESEYKKGLRPVLWLSPNFPLRTEELLPLLDILANKVKAIRRLRDLLTTKLPPDT
FPVKVAIPVVPTIRVLVTFTKFEELQPLEEFGTPPSSPDKSKSPAVQPPSSSWIQWIKAP
YYRQMNLSTAPGPSSRVEDIHHQDPFAIPSDYVWTTPEEKKKKTQENKNRSKKGRNG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):59GC content divergence:0.017
Length 1 (bp):1965Length 2 (bp):1974Length divergence:0.002
MFE 1 (kcal):-784.46MFE 2 (kcal):-809.35MFE divergence0.016