Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140602-GRMZM2G403149
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193077
Function (paralog2):hypothetical protein LOC100274701

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.39946723181788
Log2 mRNA fold difference:-1.3193119901766
Log2 TE fold difference:0.92684936134603
Sequences
Protein sequence

MVKRSKKSKSKRVTLRQKHKVLRKVKEHHRKKRKEAKKEGKAGQRKKVEKDPGIPNEWPF
KEQELKALEARRAQALQELELKKEARKERARKRKLGLLEDEEIANLASAASAQGSEFAAK
DAAKDKAPLTVAKSNDHSERSFYKELVKVIEASDVILEVLDARDPLGTRCIDMEKMVRKA
DPSKRIVLLLNKIDLVPKEAVEKWLTYLREEMPTVAFKCNTQEQRTKLGWKSSKLDKTNI
IPQSSDCLGAENLIRLLKNYSRSHELKLAITVGIVGLPNVGKSSLINSLKRSRVVNVGST
PGVTRSMQEVQLDKKVKLLDCPGVVMLKSSNSGVSVALRNCKRVEKMEDPVTPVKEILGI
CPHEKLLSMYKVPSFSSVDDFLQKVSTVRGKLKKGGVVDVEAAARIVLHDWNEGKIPYFT
LPPKRDAVEDSDVVIISEDGKEFNIDEIYKAESSYIGGLKSIEEFHHIEIPPNAPPAIDE
EMLEDGSKPSEPAQENREEQMSDANDPQGSKPATASTQNDKLYTAEGILDPRKRKAEKKR
RKANRFSVLNDMDADYDFKVDYQMEDAADGEDEDAGDEAKEDNEPMTGVDDS*

MVKRSKKSKSKRVTLRQKHKVQRKVKEHHRKKRKEAKKAGKAGQRRKVEKDPGIPNEWPF
KEQELKALEARRAQALQELELKKQARKERAQKRKAGLLEDEDIASLASAASAQGSEFAAK
ENAPLLVAKINDHSERSFYKELVKVIEASDVIVEVLDARDPLGTRCIDMEKMVRKADPSK
RIVLLLNKIDLVPKEAAEKWLTYLREELPTVAFKCNTQEQRTKLGWKSSKLDKTSNIPQS
SDCLGAENLIKLLKNYSRSHELKLAITVGIVGLPNVGKSSLINSLKRSRVVNVGSTPGIT
RSMQEVQLDKKVKLLDCPGVVMLKSSNSGVSVALRNCKKVEKIEDPVAPVKEILSICPHE
KLLSLYKVPNFGSVDDFLQKVATVRGKLKKGGVVDVEAAARIVLHDWNEGKIPYFTLPPK
RDAGEDSDAVIISEDGKEFNIDDIYKAESSYIGGLKSIEEFHHIEIPPNAPPAIDEEMLE
DGGKKPSEAIQESRDREEQMPDVKDSGGSKAASASTQNDKLYTAEGVLDPRKSKAEKKRR
KASRPSALNDMDADYDFKVDYRMEDGGSEGAHADDEDGGDGSEDNEPMTGVDDA*

Other information
Ka divergence:0.21682KaKs divergence:0.206416
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1779Length 2 (bp):1785Length divergence:0.002
MFE 1 (kcal):-582.8MFE 2 (kcal):-571.8MFE divergence-0.01