Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140609-GRMZM2G163561
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192600
Function (paralog2):hypothetical protein LOC100192600

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4809949174611
Log2 mRNA fold difference:2.6566678041092
Log2 TE fold difference:-1.151176298626
Sequences
Protein sequence

MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ
PNSAIRKCARVQLVKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK
VVKVSGVSLLALFKEKKEKPRS*

MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ
PNSAIRKCARVQLVKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK
VVKVSGVSLLALFKEKKEKPRS*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):429Length 2 (bp):429Length divergence:0
MFE 1 (kcal):-146.4MFE 2 (kcal):-136MFE divergence-0.037