Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140612-GRMZM5G852329
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282546
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.3246894434399
Log2 mRNA fold difference:2.5888323891054
Log2 TE fold difference:-0.26619875956237
Sequences
Protein sequence

MAQGINFPDFIGAVGGHDGGVDFGGNFCDMAFYQKLGEGTNMSVDSLNSMQTSMHGGSIA
MSVDNNSSVGSNSDSRTGMLGHPGLKGPAIVGSYSVGHSIFRPGRVSHALSEDALAHALM
DNKFPTETLKDYEEWTIDLGKLHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEK
AQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSKRQNRSV
PLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMT
PETGTYRWMAPEMIQHRPYNQKVDVYSFAIVLWELVTGNVPFANMSAVQAAFAVVNKGVR
PAIPHDCLPALAEIMTMCWDTNPEVRPPFAEIVRMLEQVEVEVLTTVRKARFRCCIAQPM
TLD*

MAQGANFPGFIGAVGGHDGGVNFGGNFCDMAFYQKLGEGSNMSVDSLNSMQTSMHGGSIT
MSVDNNSSVGSNSDSRTGMLGHPGLKGPVIVGSYSVGHSIFRPGRVSHALSEDALAHALM
DNKFPTETLKDYEEWTIDLGKLHLGMPFAQGAFGKLYRGTYNGMDVAIKLLERPEADPEK
AQLLEQQFVQEVMMLATLRHPNIVKFIGACRKPLVWCIVTEYAKGGSLKNFLSRRQNRSV
PLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMT
PETGTYRWMAP*

Other information
Ka divergence:-0.222452KaKs divergence:-0.514323
GC content 1 (%):53GC content 2 (%):51GC content divergence:-0.019
Length 1 (bp):1272Length 2 (bp):936Length divergence:-0.152
MFE 1 (kcal):-475.2MFE 2 (kcal):-346.2MFE divergence-0.157