Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140674-GRMZM2G181540
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277970
Function (paralog2):hypothetical protein LOC100274154

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.077840156747664
Log2 mRNA fold difference:0.64634490108096
Log2 TE fold difference:-0.94112395153402
Sequences
Protein sequence

MGNCQAAETATVLIQHPGGGRTERAYWALSAGAVMAANPGHYVAAVITVPQPGGAGDDGA
ASASAAAPVKHLKLLRPDDTLLLGRVYRLVSFEEVLREFASKRHVKLSRVTVRAKDEGED
VKPAPKHRRRRASGGGERKESERSLAKVMGQTEEQLVPEAGPASGPAPSSSKQGDADTPA
GLDADLEALLQPHGALLGRRAGRQWRPALQSIAEGEG*

MGNCQAAEAEAATVLIQHPGGGGTERAYWALSAETVMAANPGHYVAAVITTAQPDAGDGA
ASSAAAPVKHLKLLRPDDTLLLGRVYRLVSFEEVLREFASNKRQVKLSRVTVRAKDEDED
VKPASKHRRASGDVGERKESERSLAKVLRQTEELEPEADPSSGPSAKHRQADTDTPADLE
ALLPHRALLGHRAARQWRPALQSIAEGGG*

Other information
Ka divergence:0.13526KaKs divergence:0.163526
GC content 1 (%):74GC content 2 (%):70GC content divergence:-0.028
Length 1 (bp):654Length 2 (bp):630Length divergence:-0.019
MFE 1 (kcal):-371.5MFE 2 (kcal):-309.1MFE divergence-0.092