Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140694-GRMZM2G589696
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216759
Function (paralog2):hypothetical protein LOC100193142

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7994183655838
Log2 mRNA fold difference:-1.9400290377006
Log2 TE fold difference:-0.024894089753674
Sequences
Protein sequence

MMAGAPPMHICLDSDWLKGIVPEEPGMGSSSPSAELIACPRPMHATAAAADRRLRPQHDQ
PLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRASAK
KPPAPPMQPPHMSETGLHLSFSGVQQLPPADPLCSLGLLDWKYDPILTGSGGVAGSLDGA
SSETHFAGTGMLGIPGGSGGGECHALSALRYAAGLGENLQVQGLPFGARAEHDAMEMKPA
ATDRLLSLDWYSETSRAPESAISSLGALGLWSGMLGGAHQHHGSSAAI*

MMAGAPPTMHICMDSDWLKGIVVPEEPGMGGSSSSPSAELIACPRPPMHAAAADHRRLRP
QHDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKR
ASAKKHPAATPMQPRHVAETGLHLSFSGVQLPPPPSPAAAADPLCSLGLLDWKYDPILAG
SGGAAAGSLDGASSEAHFAGAGMLGIPGGGECYALSSLRYAADLGEHLQLQGLPFGLRAE
QESMEVKAAATERTLSLDWYSETSRAPESALSSLGALGLWSGMLRGAHQHHGSSAAI*

Other information
Ka divergence:0.162676KaKs divergence:0.285656
GC content 1 (%):68GC content 2 (%):70GC content divergence:0.014
Length 1 (bp):867Length 2 (bp):894Length divergence:0.015
MFE 1 (kcal):-431.5MFE 2 (kcal):-451.24MFE divergence0.022