Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140721-GRMZM2G140752
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100280312
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.85616206132484
Log2 mRNA fold difference:-2.4018386630062
Log2 TE fold difference:1.6191047685342
Sequences
Protein sequence

MHSLLPILLCSFLLATAANADNPFYTGCPNNTNYTRGSAFQANLNALLASLPSAAAASAG
FATNTTGTAPDQAYGLAQCRADVNASDCRACLDGSTRDMARVCPGQKSAMLIYDACQLRH
SNASFFGAVDASVVVWQPNAQNATQQEQFTTRLGALMGSVTERAAYASPRRFAVGSAAVT
PFVNVYGMAQCTRDLAGDDCNRCLVGAVSFIPTCCDGRQGARIVYPSCSIRFEVYPFYDA
QAADAAMSPAPAPGAGSVNGSDQSGLGESGSGSHKVRAALLVAIPVAVALLQVAVFLFLR
KRNRQPHKHVQVASNVHEDEEDMTSSEYLLYDLSTLRAATDNFSEENKLGEGGFGPVYKG
TLQDGQEIAVKRLSATSQQGQVEMKNEVVLLAKLQHRNLVRLLGCCTEEHERLLVYEFLT
NNSLDKILFDPARRQELGWGLRQRIIEGIGRGLLYLHEESRLTIIHRDLKASNILLDADM
NPKISDFGLAKLFSLDSSVGNTSHIAGTYGYMAPEYAMHGLFSAKSDVFSYGVLVLEIVT
GRRNSYTHASGPSEDLLTFVWTHWSRGSVQPLLEGCPDEGLRAQEMLRCIHVALLCVQED
PLDRPSMASVVVMLNSRSITLPAPGAPAYAVPRRGTTVRSAARQGLVDAAASREQSVNGA
SFSDMEPR*

MQLPLPSPGLGAMWSLLPLLLFLSSSLLAATTIAYDLWYTECASNTNYTRGGAFQANLDA
LLSSLPAAAAASYGFADNFTGAAPDQAYGLAQCRGDVNASTCLACLDGAARHMAATCPGQ
KDAMLIYDECLLRHSNASFLGAADASVRFCAWNPQNATQPEEFRTRLGALMGNLTARAAF
ASPRMFAAGKAAVSPFANVYGMAQCTRDLADDDCNRCLDGVVAFIPNCCDGKQGGRVIAR
SCSIRFEVYSFYDALGAQEAMSPAAAPVPGGGPTNGSGHSVDGNTGSSSHTVRTALLVAI
PVAVALLLLVAVFLFLCRRNRQLHKHVQVASSVHEDEEDMRSSESLLYDLSTLRAATDNF
SEENKLGEGGFGPVYKGTLQDGQDIAVKRLSATSQQGQVEMKNEVVLLAKLQHRNLVRLL
GCCTEEHERLLVYEFLTNNSLDKIIFGDSRRHELGWGLRQRIIEGIGRGLLYLHEDSRLT
IIHRDLKASNILLDADMNPKISDFGLAKLFSIDSSVGNTSRIAGTYGYMAPEYALHGIFS
AKSDVFSYGVLVLEIVTGRRNSYTHASGPSEDLLTFVWTHWSRGSVQPLLEGCPDEGLRA
QEVLRCIHVALLCVQEDPHDRPSMASVVVMLNSRSITLPAPAAPAYAVPGRAVTASENPP
RRMSLGRQGPMAAAREPSINEASVSELHPR*

Other information
Ka divergence:0.170094KaKs divergence:-0.185562
GC content 1 (%):64GC content 2 (%):65GC content divergence:0.008
Length 1 (bp):2007Length 2 (bp):2073Length divergence:0.016
MFE 1 (kcal):-927MFE 2 (kcal):-980.5MFE divergence0.028