Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140893-GRMZM2G000764
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSRPLYRGVSGIGGKLAAADEAYYDPKEPSENGIGGGFGRGGARKRHLAAAAVKIGVLLL
LAAALVGSVAWAGTLYAGRGAAARAAAAAAHRGYRRLQEQLVTDLLDIGELAGGGVRAKE
AEVCPPEYDNYVPCYYNITDAVDVSDLGAGVVISYDRQCTRDGRVTCLVAPPRSYRVPVR
WPSGKGFIWKDNVRISGQEFSSGSLFKRMMVEEDQISFPSDAHMADGVEDYAHQIAEMIG
LRNEFNFNEAGVRTVLDIECGFGTFGAHLFERDLLTMCIANYEASGSQVQITLERGIPAM
IGSFATKQLPYPYLSFDMVHCAKCNIEWYKNDGIFLVEVNRLLRPGGYFVWTSNLNTHRA
LRDKENQKKWTAIRDYAEGLCWEMLSQQDETIVWKKTNKRECYKSRKFGPELCGHDPESP
YYQPLSPCISGTRSQRWIPIEHRTTWPSQARQNSTELDIHGVHSEVFADDNSSWDSMVRN
YWSLLSPLIFSDHPKRPGDEDPQPPFNMLRNVLDMNAHFGGFNAALLKSGKSVWVMNVVP
TNAPNYLPLIFDRGFIGVQHDWCDAFATYPRTYDMVHADGFLSLEKTHKHRCSTLDIFLE
VDRILRPEGWVIIRDTAPLIEAARSVVTQLRWDARILDLDIASDEKLLVCQKPFLRK*

MSRALYRGVSGIGGKLAAADEAYAYYDPKEPSENSIGGGFGRGGARKRHLADAAVKVGVL
LLVAAALVGSVAWAGTLYAGRGAAARAAAAAAHRGYRRLQEQLVADLLDIGELAGGGARA
KEAEVCPPEYEDYVPCYYNVTDAVDVSDLGAGVAISYDRQCTRDGRVTCLVAPPRSYRIP
VRWPSGKGFIWKDNVRISGHEFSSGSLFKRMMVEEDQISFPSDAHMADGVEDYAHQIAEM
IGLRNEFNFNEAGKYCMLSRLAGSAGLFLLNLTNIHAQCAGKCMSEFTTVPAKVRTVLDI
ECGFGTFGAHLFERDLLTMCIANYEASGSQVQITLERGIPAMIGSFATKQLPYPYLSFDM
VHCAKCNIEWYKNDGIFLVEVNRLLRPDGYFVWTSNLNTHRALRDKENQKKWTAIRDFAE
GLCWEMLSQQDETIVWKKTNKRDCYNSRKSGPELCGHDPESPYYQPLNPCISGTRSQRWI
PIEYRTTWPSQARQNSTELDIHGVHPEVFADDTSSWDSMVRNYWSLLSPLIFSDHPKRPG
DEDPQPPFNMLRNVLDMNAHFGGFNAALLKAGKSVWVMNVVPTDAPNYLPLIFDRGFIGV
QHDWCDAFPTYPRTYDMVHADGFLSLQKNHKHRCSTLDIFLEVDRILRPEGWVIIRDAAP
LIEAARSVVTQLRWDARVLDLDIASDEKLLVCQKPFLRK*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):1974Length 2 (bp):2100Length divergence:0.031
MFE 1 (kcal):-758.92MFE 2 (kcal):-803.15MFE divergence0.028