Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G140989-GRMZM2G442387
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.3957032388461
Log2 mRNA fold difference:0.23116321460505
Log2 TE fold difference:1.1900452079505
Sequences
Protein sequence

MMYRKGRDSNGDKSQEGGGDVPPSIKLDITDHPASGGGKTASFSEPWTPTPGSGSCRGSS
SSSSGRSDPPEKQLTLLALRVAILEKAASGLGKLDFVWATVVLLGGFVSTLNITDFWCIT
VILVGEGARVFSRSHELEWQHHATETSTAGGGLLRSSSRFFRRILHAFVDHTGGGGRNEE
EPHQHATPTTDAGGVLPLPPLRSCRRFFRRAVHALAHPGAGGADVGGDAITTSAMFQNQI
VAVVKKRTGHAPNDVSLIPYTGRMFTYRNIGRLLNCLQVLSAFACVALSLMRLWKHDFGS
GGNMRPALLLFYTLALLEALLFLLEQAYWTWKFSFCKLLRHVSEDCQLGAYGHVSLTRFF
YDAYSRCVTGSIFDGIKMDLVTFAEDLILSDFLDEQLIGVRILEQFAMKVNSAGDTLRKV
GTSPRSVERLVEMLNWKRPDEVEVRQLAAEVVCKLAGERQNALRLSAIPGAIESVMSLLY
TGRSAAVSGMHPQPNHAAGEGRDFDNDYLPLNLLGLSILEKLAKDQDNCGKISNARGLLA
KIIDFTQTSKDLLGSQCVSDSAVSAVKCALQVVRMLVSTTGNTGHALRQGVAENVFAVCN
LRGILRYGQRHKELQMLTIDVLTALALDDSGKEAIMGTGGLVKLLLSIFISAEEGELGHG
AGEALAMLALESETGCAAILKRADVLQLVSALLDGDDARRLHAARVLRSLCAYSGPEYRE
RLRVVTKLLPVVLGITMTKSNKVLEVCIGLTTQICTFIDGDRFAAELRGAGVEEGAYVHR
LATILGENEYPKVKIPRMRRFVVQQVIWLMACSGGGSYMELLRGVGMERLLESIADTTSE
LECYHVFSGSVGIGKHRESFPDIVDSALELIKGGGDRAPAPAPAPAEK*

MELESQPRRQESMRMRCGSADQRVDRPESTSWSAAAASAGLASFLPSASPPRCAAVKKSG
SASAVDVWIRKDERSGRGPCPQVGTSRDVRAAGELTVGAESLIQSASTVLDSSLPKFPIP
VLERKRRAVQRNWVALLFDFLSRPFRPLVVGVARGIPPSFPPPPFSGSASLGLAEVLAPA
SMKYKKSRDATGLGSNGDGGWQKGGGDVPPSIQLDIMEHRGAAATTGLGTGGTAGSASFF
EPWRERTPGSSGSGRGSSGGGGDGREPPEKRLTLFALRLAVLEKAASGLGKLDFVWATVV
LLGGFASTLSITDFWCVTVILVGEGARVFGRSHELEWQQHATQTSTAGGALRSSSRFFRH
IVHALVDPAAAAAGGRRNDDDDARARAALFQRQIVAFMRRRAWHAPDVSLLPYTGWVFVS
RKIGRLLNWMQVLSALACVVLSVMRLWKQDFGGRDSRNMRPALLLFYTLALVEASLFLFE
KAYWTWKVSVCKLLHQVSAECELGPYGLVSLKRFFYDAYSRCIAGSIFDGIKMDLVTFAE
DLILSDFLDEQIIGVRILQQFANSERSASDTLRKVGTTPRSIDRLVEMLNWKRTEEDEVR
LCAAEIVSKLASKRQNALRVSGIPGAIESVTSLLYTATSPPVSGTHPQLPGAPAEHGASP
PAASRGYDHLQFNLLGLLILKRLARDHDNCGKIGNARGLLAKVINFTQASRALLQNPHVT
DSQVRAMKRALKVVKMLVSTTGSTGKALRESVAENVFTVSNLRGILRYGQQHRELQKLAT
DVLTGLAMHDSGKEAIVATGGVVKLLLSIFFNVQDTELGREAGEALAMLALESEAGCAAI
LRQTDVLDQLVSALQDGDARRRLNAARVLRNLCAYSGQQQRERLRVVTKALPAVLNATKV
DKDRILEVSVGLSTEICQFIDGEQFAAELRGAGVADERAYVELLASILKQYRYPDIRVPR
MRRFVVQQVIWLMTSSGGGGDHSGGYVQLLREVGMKRLLESIADTTSELECYHVFSGSVG
ISKHRESFSAIVDSALELIAGSGDGARAED*

Other information
Ka divergence:-0.214337KaKs divergence:-0.140658
GC content 1 (%):64GC content 2 (%):66GC content divergence:0.015
Length 1 (bp):2667Length 2 (bp):3153Length divergence:0.084
MFE 1 (kcal):-1246.12MFE 2 (kcal):-1566.69MFE divergence0.114