Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G141273-GRMZM2G145451
Species:maize
Duplication type:WGD
Function (paralog1):P-protein
Function (paralog2):hypothetical protein LOC100273905

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.175827326972
Log2 mRNA fold difference:-0.2041309435095
Log2 TE fold difference:-0.96425035654398
Sequences
Protein sequence

MAPTACLRTPFFPARARSTNATPFSPHRRFSLKCSASNGDNSNPNSISISPTSPPRLTVS
DGVESVDVNGLRRPPAPASVPAARDPHWLPRPLTSADVMEVDGKGLKVAYQGCAGAYSEA
AAKKAYPNCETVPCEHFDTAFQAVQNWVADRAVLPLENSLGGSIHRNYDLLLRHSLHIVG
EVRLAVRHCLLANPGVKIENLKSAMSHPQALAQCEHTLTSLGIEHREAVDDTAGAAKIVA
EHMLQDTGAIASSLAAKLYGLDVLAENIQDDKDNVTRFMMLAREPIIPRTDKPFKTSIVF
SLEEGPGQLFKALAVFALRDINLTKIESRPHKERPLRVSDDCSSLLKNFDYLFYVDLEAS
MADPKTQNALGNLKEFATFLRVLGSYPTDVNEP*

MAPTTCLRIPFLPARGRSANVNAPPSWLPRRLSLKSSATNGDNSLPNPISTSPTSPPWLT
VVDVNGLRRPPAPVSAPTIPGDRGPRWLPRPFTSADVMGADWKGLKVAYQGCAGAYSEAA
AKKAYPNCEAVPCEHFDTAFQAVQNWVVDRAVLPLENSLGGSIHRNYDLLVQHSLHIVGE
VRLEVHHCLLANPGVKIENLKSVMSHPQALAQCEHTLTGLGIEHREAVDDTAGAAKIVAE
HMVQDTGAIASSLAAKLYGLDVLAENIQDGKNNVTRFMMLARKPNILRNDRPFKTSIVFS
LEEGHGQLFRALGVFAQRKINLTKIESRPHKERPLRVSDDCSSLLKNFDYLFYVDLEASM
ADPKIQNALGNLKEFATFLRVLGSYPTNVNEP*

www.000webhost.com

Other information
Ka divergence:0.708286KaKs divergence:0.508868
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):1182Length 2 (bp):1179Length divergence:-0.001
MFE 1 (kcal):-376.54MFE 2 (kcal):-398.7MFE divergence0.029