Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G141386-GRMZM2G145562
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191956
Function (paralog2):hypothetical protein LOC100216697

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.59449233974
Log2 mRNA fold difference:-0.028654077291139
Log2 TE fold difference:-1.5703761809544
Sequences
Protein sequence

MTMMAPHPQPLPLPQPPAPFGDTTLTKVFVGGLAWETHKDALREHFERYGDILEAVIISD
KLTGRSKGYGFVTFKEADAAKKACEDATPVINGRRANCNLAALGAKPRPPPHILRPSPPA
TPAPHAPALPSQHQPTPAIAVGSRGVSPVPWYYHPSTTPPPPAAHHYAHGAHQQYHGVLP
FYPAAAATYGYAPNYVADLSYNAKVGQAAAGGTGGSYLQGHFAYPAAAAAQGGMVAAAPN
GMVPVYPFYHYHQYHASQGGVAAAHFFPPVSAAAVPAVVSKHTVMAAPKVEQVTGCS*

MTMMAPHPQPLPLAQPPAFGDTTLTKVFVGGLAWETHEGALRGHFQRYGDILEAVIISDK
LTGRSKGYGFVTFKEADAAKKACEDATPVINGRRANCNLASLGAKPRPQPLQHVLRPSPP
HAHALPSPHQPTPAIAVGSRSVSPVPWYYHPSTTRPPPPPAAHQQYHGVLPFYPAAATYG
YSPNYVTDLSYNTKVGQAAAAGTAAGSYLQLQGHLAYQAAPAQGGMVPVYPFYHYPYHAS
HSQGLGVPAAHFLPPVSAAAVVSSKPTVVATPKAVEWSG*

Other information
Ka divergence:0.452298KaKs divergence:0.257778
GC content 1 (%):72GC content 2 (%):70GC content divergence:-0.014
Length 1 (bp):894Length 2 (bp):840Length divergence:-0.031
MFE 1 (kcal):-434.3MFE 2 (kcal):-374.19MFE divergence-0.074