Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G141665-GRMZM2G165769
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100272718
Function (paralog2):hypothetical protein LOC100280172

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-4.3405844327363
Log2 mRNA fold difference:-4.0809334531105
Log2 TE fold difference:-0.23776917750081
Sequences
Protein sequence

MASFFRDARLPQQRVVEGVPFPAVLVPSAPAGGGLDEFLAAVRSERASRLEPLVRHAGAL
LLRGFPATTAADFDRAVDAFGYEELPYVGGAAPRTNVVGRVFTANESPPDQKIPFHHEMA
QVPTFPSKLFFFCEVEPKSGGETPIVLSHYVYKRMQEEFPEFVEKLEKEGLVYTRVLGEG
DDPSSPIGRGWQSTFLTKDKAVAEERAAKLGMKLEWTGDGVRTVMGPIPAVKWDESRGRK
VWFNSMVAAYTGWKDARNDPVKAVTFGDGSPLPADVVAACGRVLEEECVAVPWRRGDILL
LDNWAVLHSRRSFEPPRRILASLCK*

MASFFRDARLPQQRVVEGVPFPAVLVPSARAGSCAGGVDKFLAAVRCERASRLEPLVRDA
GALLLRGFPATTAADFDRAVDAFGYEELPIVGSVAPRTNVVGRVFTANDSPPDQKIPFHH
EMAQVPTFPSKLFFFCEVEPKSGGETPVVPSHYVYKRMKEKFPGFVEKLEKDMIVYTRVL
GEGDNPSSSIGRGWQSTFLTKDKAVAEERAAKLGIKLEWTDDGVKTVMGPIPAVKWDESR
GRKIWFNSIVAAYIGWKDARNDPMKAVTFGDGSPLPADVIDACGQVLEEESVAVPWQHGD
ILLIDNWAVLHSRRSFEPPRRILASICK*

Other information
Ka divergence:0.276633KaKs divergence:0.144667
GC content 1 (%):67GC content 2 (%):63GC content divergence:-0.031
Length 1 (bp):978Length 2 (bp):987Length divergence:0.005
MFE 1 (kcal):-499.7MFE 2 (kcal):-462.7MFE divergence-0.038