Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G142013-GRMZM2G056606
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGGDHGGGHAGGDFRQKVWSMTGGPYCRPVHWRRNTAIAMFGVFLICIPIAMKSAELEVP
ELGPFFQAGAMLLKDSNARITQSGQSHLNCGAKTLVRRNTEGPSN*

MGGDHGGGHAGGDFRQKVWSMTGGPYCRPVHWRRNTAIAMFGVFLICIPIAMKSAELEQR
PHHPVRPIPSQLWCKNFGKEY*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):62GC content divergence:0.025
Length 1 (bp):318Length 2 (bp):246Length divergence:-0.128
MFE 1 (kcal):-122.8MFE 2 (kcal):-95.6MFE divergence-0.125