Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G142072-GRMZM2G171488
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.36036017333934
Log2 mRNA fold difference:0.31589343305394
Log2 TE fold difference:0.043651779858328
Sequences
Protein sequence

MARRGHDDDDDEVDEEEEEDAYDLDDDEDEDEEDDYEEETRRGKASRGGGGAKSGGGRKR
SREDNFIDDSAIEDEDDEDDDGGGRPRKKGGGGVRGFFDEEAQVDEDEEEEDEGEGEDDF
INDAGADLPDEDVVRGSRRHSIPMRDEEEDIDEMERQVRERYARSTHIEYGEEAAEVEQQ
ALLPSVKDPKLWMVKCAIGHERETAICLMQKFIDRSDLQIKSVVALDHLKNYIYVEAEKE
AHVKEACKGLRNIYASAKITLVPIKEMADVLSVESKSVDLSRDSWVRMKLGIYKGDLAKV
VDVDNVRQRVDVKLIPRIDLQALASKLEGRDIVKKKAFVPPPRFFNIDEAREMHIRVERR
RDKESGEYFEWVDNLKFKDGFLYKSVSTKSIHKSNIQPTFDELEKFKKPGDDMNGDMASL
STLFANRKKGHFMKGDAVIVIKGDLKNLEGWVEKVEDETVHIRPKISDLPKTLAFNEKEL
CKYFKPGDHVKVISGVQEGATGMVVKVEGHVLIILSDTTKEHIRVFADHVVESSEITTGI
TRIGDYELHDLVLLDNLSFGVIIRVEAEAFQVLKGVPDRPEVVLVKLREIKSKIERRSSA
KDRSNNIISAKDVVRVVEGACKGKQGPVEHIHKGMLFIYDRHHLEHAGFICAKAQSCLLV
GGSTGGRRGNGMDTADARLDALRSSASILQSPGRLPPRGPNMNYGGRFGGGRGGRGYDAL
VGKCIKIKSGPYKGYRGRVKEVTGALVRVELDSLMKIVTVKRDDIADTPTVATPFREPRY
SLGGETPMHPSRTPHHAYQTPMRDPGATPIHDGMRTPMRSRAWAPMSPPRDNWEDGNPAT
WGSSPAYQPGTPQARPYEAPTPGSGWANTPGVSFNDAPTPRDNYANAPSPYVPSTPVGQP
MTPNSASYLPGTPGGQPMTPGNAGMDMLSPIIGGDGEVAWLLPDVLVNVLRGGDDGPGVV
REVLGDGSCRVALGSSGNGDVVTVLANEVEVIRPKKSDRIKILNGNFRGYTGKLIGIDGS
DGIVRLDETYEVKILDMVILAKLAT*

MARRDHDDDDEEEVEEEAYDLDEEEDDEDEEDDYEEEARRGKASRGGGKGGGGRKRSRED
NFIDDSAIEDEDEDDDDDGGGRPRKKGGGGVRGFFDEEAQVDEDEEEEDEGEGEDDFIND
AGADLPDEDVVRGSRRHSIPMRDEEEDIDEIERQVRERYARSTHIEYGEEAAEVEQQALL
PSVKDPKLWMVKCAIGHERETAICLMQKFIDRSDLQIKSVVALDHLKNYIYVEAEKEAHV
KEACKGLRNIYASAKITLVPIKEMADVLSVESKSVDLSRDSWVRMKLGIYKGDLAKVVDV
DNVRQRVDVKLIPRIDLQALASKLEGESVKKKAFVPPPRFFNIDEAREMHIRVERRRDKE
SGEYFEWVDNLKFKDGFLYKSVSTKSIHTNNIQPNFDELEKFKKPGDDMNGDMASLSTLF
ANRKKGHFMKGDAVIVIKGDLKNLEGWVEKVEDETVHIRPKISDLPKTLAFNEKELCKYF
KPGDHVKVISGVQEGATGMVVKVEGHVLIILSDTTKEHIRVFADHVVESSEITTGITRIG
IIGKMEILLLGVAVQLTRCVTPTCLTPIIQNFQPGTPQARPYEAPTPGSGWANTPGVSFN
DAPTPRDNYANAPSPYVPSTPVGQPMTPNSASYLPGTPGGQPMTPGNAGMDMMSPIIGGE
GEATWLLPDVLVNVLSGGDDGPGVVREVLGDGSCRVALGSSGNGDMVTVLPNEVEVIRPK
KSDKIKILNGSFRGHTGKLIGIDGSDGIVRLDDTYEVKILDMVILAKLAT*

Other information
Ka divergence:0.271329KaKs divergence:0.229739
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):3138Length 2 (bp):2313Length divergence:-0.151
MFE 1 (kcal):-1045.05MFE 2 (kcal):-762.09MFE divergence-0.157