Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G142088-GRMZM2G106308
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383153
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAEDPAAEQETRQLEDRLREVGERLQAPPDDAEDLLNLLIEVEECLLKVEQSPPESTSNA
LQLATAALVKKELLAHADSNIRLAVASCISEITRITAPDAPYDDDAMKDVFSLIVEAFKH
LDDIESPFFGRRTSILDTVAKVRSCVVMLDLECDDLINDMFHHFLRTVNSGHSEAVICCM
ETIMRLVIEESEDVQPQIASCLLQNVRKEEKESSSASFELAEKVIGTCREKLKPVFLQSL
KGTSLSEYSQIVASVCEDVSDDREDNNADPSGKDTVDDGKLSERTISDELPQESSKAEQD
VSRPEQDGTCMNGNTGTAISSGATLPDTSESDQGPPKEKTEQPCYADDITDTDQLKSDHN
EGAEFDTAKPEKKAAVDSDKSAKLKLSDKCEAPVHSDADTKKEASAEGTDGAADDTSTAA
DCTPKPKRGRPPGPKSSQKKAAGKDQSSGSDLKKVNEAGDSAGKLAKRSAKDEKSTKKAG
EGESSKKTQKYNSKQQKDENLSEDPAKDLSLKEMITPKSSTKVPGRTKGQSTENSTPKMK
QEQETEEPPRSRKSKGLDKSLVGARIKVWWPDDKMFYNGVVESFDSVSKRHKVAYDDGDV
EVLLLRDEKWEFISEEKGASVASETPGGRKRKADAVKEENTETPKSDAVDHPKKRGRPKG
VRSSNGTPSNSATPSTKGKTAGKNTKETPKTGPNLIKELEKSSKDKASVSTETKDELPKD
DRSASRPKEAISKGKDSKDEGKSTEGKARPGRKLKNAGTPAGDADKEKGKEKEVKAAEIE
QEAPGNASTGKKRRRKA*

MAEDPAAEQETRQLEDRLRDVGERLQAPSDDAEDLLNLLIEVEECLIKVEQSPRESISNA
LRPATEALVKKELLGHADSNVRLAVASCISEITRITAPDAPYDDDAMKDVFSLIVGAFEH
LDDIESPFFGRRTSILDTVAKVRSCVVMLDLECDDLINDMFHHFLRTANSGHSEAIISCM
ETIMRLVIEESEDVQPQIASCLLQNVRKEEKESSPSFELAEKVIGTCREKLKPVFLQSLK
GTSLSEYSQIVASVCEEVSDDREDNNANPSGKDMVDDGKLSERTISDELPQESSKMEQDV
SRPEQDGTSMNGDTVTAISSGATPPDTSESDQGPPSTNEKIEQPCYAQNIADAMQLKSDH
NEGAESNAAKPNKKATLGSVKNTKLKPSDKCEPTVHSDADTKKQDLVASAEGSNGAADDT
SRPADSTPKPKRGRPPGPKSLQKAPGKDQSPGLDLKKVNDDSAGKLAKRSAKDEKPSAKN
TGEGEPSKKTQKNNLKQHKGETLSEDDPAKDLSLKEMISLKSSTKGPGRTKGQTTENSTP
KLKQEQETDEPPRSRKNKGLDRSLVGARIKVWWPDDKMFYNGIVESFDAVSKRHKVAYDD
GDVEVLLLREEKWEFISEEKEASMASETPRGRKRKADALKEENTETPKSDAVDPPKKRGR
PKGVGSSNGTPSTSATPSTKGKTAGKVTKETPKTGPNLKKELEKNSKDKANVSTGTKDDK
SVSKPKEAIIKGKDSKDEGKSTEGKAKPGRKPKNAGTPAGDSDKEKQEVEVKAAEIEEAS
GNASTGKKRRRKA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2394Length 2 (bp):2382Length divergence:-0.003
MFE 1 (kcal):-736.6MFE 2 (kcal):-723.96MFE divergence-0.009