Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G142334-GRMZM2G164185
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383125
Function (paralog2):hypothetical protein LOC100191387

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.70307930197206
Log2 mRNA fold difference:0.60997706901649
Log2 TE fold difference:0.077014052068807
Sequences
Protein sequence

MTMNGAAAPERSPPASPPPLVQAQAPPSPSPTQPLEWRFSQVFGERSAGEEVQDVDIISA
IEFNKSGHHLATGDRGGRVVLFERTDVKDHASRKDAEKADYSISRHPEFRYKTEFQSHEP
EFDYLKSLEIEEKINQIKWCQATNCALFLLSTNDKTIKFWKVQEKKVKKVSEMNLDRSTA
PTNGSPGGTGYLRPSLSNGNVLKPGGLPLLRLPVVVTTQETSLAASCRRVYAHAHDYHIN
SISNNSDGETFISADDLRINLWNLEISNQSFNIIDVKPTNMEDLTEVITSAEFHPTHCNT
LAYSSSKGSIRLVDLRQSALCDNHSQIFEQHEAPGSRSFFTEIIASISDIKFSKDGRHIL
SRDYMTLKLWDVKMNSGPVATFQVHEYLRPKLCDLYENDSIFDKFECCQSGDGLRVATGS
YSNIFRVFGCRSGSSEATTLEATRNPTRRQVQTTSRATRSLSTLTRAVRRGGESTGIDAN
GNSYDLSTKLLHLAWHPSENLIACAAANSLYMYYA*

MNGAAAPERSPSPSPPPPAQAQAQAPPSPSPAQPLEWRFSQVFGERSAGEEVQEVDIISA
IEFNKSGHHLATGDRGGRVVLFERTDVKDHACRKDAEKADHSISRHPEFRYKTEFQSHEP
EFDYLKSLEIEEKINQIKWCQAANGALYLLSTNDKTIKFWKVQEKKVKKLSEMNLDRSAA
PANGSPGGVGYLSPSLSNGNALKPGRLPLLRLPVVVTSQETSLATSCRRVYAHAHDYHIN
SISNNSDGETFISADDLRINLWNLEISNQSFNIIDVKPTNMEDLTEVITSAEFHPTHCNT
LAYSSSKGSIRLVDLRQSALCDTHYQIFEQHEAPGSRSFFTEIIASISDIKFSKDGRHLL
SRDYMTLKLWDVKMNSGPVATFQVHEYLRPKLCDLYENDSIFDKFECCQSGDGLRVATGS
YSNIFRVFGCGTGNSEATTLEATRNPTRRQLQNPTRATRSLSSLTRAVRRGGESTGIDVN
GNSYDLSTKLLHLAWHPSENLIACAAANSLYMYYA*

Other information
Ka divergence:-0.143536KaKs divergence:0.00896495
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1548Length 2 (bp):1548Length divergence:0
MFE 1 (kcal):-458.55MFE 2 (kcal):-478.09MFE divergence0.021