Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G142712-GRMZM2G461557
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276041
Function (paralog2):hypothetical protein LOC100216964

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.8738227566093
Log2 mRNA fold difference:0.05214871564923
Log2 TE fold difference:-0.91428074236444
Sequences
Protein sequence

MEAEYPHQQAAPSYSTTATVFWPYATRRRKRAEDGSDLSLASDMDLDADAQRAADKLKAV
SEELGHEIRVFSSENFALQPSKLPSADHEEGDDFYELQPADYYNLISNRMGELSKMLKTR
KMREAELAAQRAKRTKAVMRVRFPDGYILEADFLPSERIHSLVDLLMKVLARPDLPFYLY
TVPPKKRILDTSQDFYTSGFVPGANVHFSYDLPEGLLLNADDLKAGPFLREGILSLDGLS
LLLKPASQPDDSRMNSSTHQSGASQSDPVPTTNKKPGRPKWLKR*

MEYPHQQAGPSSTTITLICPYATRRRKRAAGDDLSSAVDMDVDADAQRATDKLKAVSEAL
GHEIRVFSSENFASQTSKLPSADHEEDDDFYELQPADYYNLISNRMGEHFKMLKTRKMRE
AELAAQRAKRTKTVMRVRFPDGYILEADFIPSERIHSLVDLLLKVLARPDLPFYLYTVPP
KKRILDTSQDFYTAGFVPGANVHFSYDLPEVSLLNADDLKAGPFLREEILSLDGLSLLLK
PASQPDDSRMNSSSLQSDASQSVPVPTTTNKKPGRPKWLKR*

Other information
Ka divergence:0.263158KaKs divergence:0.0693941
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):855Length 2 (bp):846Length divergence:-0.005
MFE 1 (kcal):-267.2MFE 2 (kcal):-253.8MFE divergence-0.026