Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G142863-GRMZM2G151041
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383579
Function (paralog2):hypothetical protein LOC100383847

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.5569560239341
Log2 mRNA fold difference:1.5857474335936
Log2 TE fold difference:-0.027740186974149
Sequences
Protein sequence

MGLFRAASGLARLALRRNLSRAAASPFAGSGGAVPGAMPARYFHSTRPRRFAAPAPRAVP
LSRLTDSFLDGTSSVYLEELQRAWEADPNSVDESWDNFFRNFVGQAAATSPGLSGQTIQE
SMRLLLLVRAYQVSGHLKAKLDPLGLEERPVPDVLDPGFYGFSEADLDREFFLGVWMMAG
FLSENRPVQTLRSVLERLEQAYCGTIGYEYMHIPDREKCNWLRDRIETVNPREYTYDRRQ
VMLDRLIWSTQFENFLATKWTTAKRFGLEGAETLIPGMKEMFDRAADLGVESIVIGMPHR
GRLNVLGNVVRKPLRQIFSEFSGGTKPVNEGEGLYTGTGDVKYHLGTSYDRPTRGGKHIH
LSLVANPSHLEAVDPVVAGKTRAKQYYSNDRDRTKNLGVLLHGDGSFSGQGVVYETLHLS
ALENYTTGGTIHIVVNNQVAFTTDPRSGRSSQYCTDVAKALDAPIFHVNGDDLEAVVHVC
ELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEPSFTQPKMYKVIRNHPSALEIYQRKLLES
GKISKEDIDKLNKKVSTILNEEFQNSKDYVPNKRDWLSAYWTGFKSPEQISRIQNTGVKP
EILKRVGEAMTTLPENFNPHRAVKKIFYQRRQMIETGEGIDWAVGEALAFATLIIEGNHV
RLSGQDVERGTFSHRHSVLHDQETGEQYCPLDHLVMNQDEELFTVSNSSLSEFAVLGFEL
GYSMENPNSLVIWEAQFGDFSNGAQVIFDQFLSSGESKWLRQTGLVVCLPHGYDGQGPEH
SSARLERFLQMSDDNPYVIPEMDPTLRKQIQQCNWQVVNVTTPANYFHVLRRQIHRDFRK
PLIVMSPKNLLRHKDCKSNLSEFDDLAGHPGFDKQGTRFKRLIKDQNNHKDLEEGINRLV
LCSGKVYYELDEERRKTERTDVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNM
GAYSYINPRLLTAMKALGRGGIEDIKYVGRAPSAATATGFYSVHVQEQTELVQKALQRDP
INYPF*

MGLFRAASGLARLALRRNLLRAAASPFAAGGGAVPGAAPARYFHSTCPRRFAAPTPRAVP
LSRLTDSFLDGTSSVYLEELQRAWEADPSSVDESWDNFFRNFVGQAATTSPGLSGQTIQE
SMRLLLLVRAYQVSGHLKAKLDPLGLEERPVPDVLDPAFYGFSEADLDREFFLGVWMMAG
FLSENRPVQTLRSVLERLEQAYCGTIGYEYMHIPDREKCNWLRDRIETVNPMDYTYDRRQ
VMLDRLIWSTQFESFLATKWTTAKRFGLEGAETLIPGMKEMFDRAAHLGVESIVIGMPHR
GRLNVLGNVVRKPLRQIFSEFSGGTKPVNEGEGLYTGTGDVKYHLGTSYDRPTRGGKHIH
LSLVANPSHLEAVDPVVAGKTRAKQYYSNDRDRTKNLGVLLHGDGSFSGQGVVYETLHLS
ALENYTTGGTIHIVVNNQVAFTTDPRSGRSSQYCTDVAKALDAPIFHVNGDDLEAVVHVC
ELAAEWRQTFHSDVVVDIVCYRRFGHNEIDEPSFTQPKMYKVIRNHPSALEIYQRKLLES
GKISKEDIDRLNKKVSTILNEEFQNSKDYVPNKRDWLSAYWTGFKSPEQISRIRNTGVKP
EILKRVGEAMTTLPENFKPHRAVKKIFDLRRQMIETGEGIDWAVGEALAFATLIIEGNHV
RLSGQDVERGTFSHRHSVIHDQETGEQYCPLDHLVMNQDAELFTVSNSSLSEFAVLGFEL
GYSMENPNSLVLWEAQFGDFSNGAQVIFDQFLSSGESKWLRQTGLVVCLPHGYDGQGPEH
SSARLERFLQMSDDNPYVIPEMDPTLRKQIQQCNWQVVNVTTPANYFHVLRRQIHRDFRK
PLIVMSPKNLLRHKDCKSNLSEFDDLAGHPGFDKQGTRFKRLIKDQNNHKDLEEGINRLV
LCSGKVYYELDEERRKSERTDVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNM
GAYSYINPRLLTAMKVLGRGGIEDIKYVGRAPSAATATGFYSVHVQEQTELVQKALQRDP
LNYPF*

Other information
Ka divergence:0.258722KaKs divergence:0.394495
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):3078Length 2 (bp):3078Length divergence:0
MFE 1 (kcal):-1144.3MFE 2 (kcal):-1138.29MFE divergence-0.003