Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G143128-GRMZM5G867882
Species:maize
Duplication type:WGD
Function (paralog1):LOC100285771
Function (paralog2):LOC100285771

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.23791907757186
Log2 mRNA fold difference:-0.068319469580122
Log2 TE fold difference:0.31491815135939
Sequences
Protein sequence

MSSDSSSWARALVQISPYTFSAIGIAVSIGVSVLGAAWGIFITGSSLIGAAIKAPRITSK
NLISVIFCEAVAIYGVIVAIILQTKLESVPTSQMYDPESLRAGYAIFASGLIVGFANLVC
GVCVGIIGSSCALSDAQNSSLFVKILVIEIFGSALGLFGVIVGIIMSSQATWPAKA*

MSSDSSSWARALVQISPYTFSAIGIAVSIGVSVLGAAWGIFITGSSLIGAAIKAPRITSK
NLISVIFCEAVAIYGVIVAIILQTKLESVPTSQMYDPESLRAGYAIFASGLIVGFANLVC
GVCVGIIGSSCALSDAQNSSLFVKILVIEIFGSALGLFGVIVGIIMSSQATWPAKA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):531Length 2 (bp):531Length divergence:0
MFE 1 (kcal):-183.3MFE 2 (kcal):-186.7MFE divergence0.009