Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G143139-GRMZM5G874955
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100384044

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.523441520896
Log2 mRNA fold difference:0.29669858318604
Log2 TE fold difference:1.2818727729912
Sequences
Protein sequence

MDREIHRVTSLRRDSSLWRRGDDVFSRQSSRFQDDEEDDDEALRWAALERLPTYDRVRRG
ILALHEGGGGEKVEVDVGRLGARESRALVERLVRAADDDHERFLLKLRERMDRVGIDYPT
IEVRYESLHVEAQVHVGDRGLPTLVNSVTNTVEIQSIGNALHILPSRKRPMTVLHDVSGI
VKPRRMTLLLGPPGSGKTTLLLALAGKLDKDLRVSGKVTYNGHGMNEFVPERTAAYISQH
DLHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAANIKPDHDIDVYMKASAMGGQE
SSIVTDYTLKILGLEVCADTLVGNEMMRGISGGQRKRVTTGEMLVGPARALFMDEISTGL
DSSTTYQIVNSLRQTIHILGGTAVISLLQPAPETYNLFDDIILLSDGHVVYQGPREHVLE
FFEFMGFRCPARKGVADFLQEVTSRKDQGQYWYRQDRPYRFVPVKKFADAFSIFHVGRST
QNELSEPFDRTRSHPAALATSKFGASRMELLKATIDRELLLMKRNAFMYIFKAVNLTVMS
FIVMTTFFRTNMKRDASYGNIYMGALFFALDTIMFNGFAELAMTVMKLPVFFKQRDLFFF
PAWAYTIPSWIVQIPITFLEVGVYVFTTYYVIGFDPNVFRFLKQYLLLLALNQMSSALFR
FIAGIGRDMVVSHTFGPLALLAFQALGGFILARPDVKKWWIWGYWISPLSYAQNAISTNE
FLGHSWSKIQNGTTVGIGVLQSRGVFTEAKWYWIGLGVLVGYALLFNLLYTVALAVLSPF
TDSHGSMSEEELKEKHANLTGEVIEVRKEKTSRRQELELSHSVGQNSVHSSEDSSQNRKG
MALPFPPLSLTFNDIRYSVDMPEAMKAQGVTEDRLLLLKGVSGSFRPGVLTALMGVSGAG
KTTLMDVLAGRKTGGYIEGDITISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLFSA
WLRLPSGINLETRKMFIEEVMDLVELTSLRGALVGLPGVSGLSTEQRKRLTIAVELVANP
SIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLMKRGGE
EIYVGPVGQNSSKLIEYFEGIEGISQIKDGYNPATWMLEVSSSSQEEILGVDFSEIYRQS
ELYQRNKALIEELSTPPPGSSDLNFPTQYSRSFFTQCLACFWKQKKSYWRNPTYTAVRLL
FTVVIALMFGTMFWDLGRKTNKQQDLFNAMGSMYAAVVYIGMQNSGSVQPVVVVERTVFY
RERAAGMYSAFPYAFGQVAIEIPYIFVQTLLYGVLVYSMIGFEWTVAKFLWYLFFMYFTL
LYFTFYGMMAVGLTPNETIAVITSSAFYNVWNLFSGYLIPRPKLPVWWRWYSWICPVAWT
LYGLVASQFGDIAHPLEDSPTGQTVAQFITDYFGFHHDFLWVVAGVHVGLTVLFAFLFSF
AIMKFNFQNR*

MVGFTILFNALFTVALTYLKPYGNSRPSVSEEELKEKHANIKGEVLDGNHLVSASSHRST
GVNPETDSAIMEDDSALTKRGMILPFVPLSLTFDNIKYSVDMPQEMKAQGVQEDRLELLK
GVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGY
CEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGV
NGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIH
QPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSSDLIKYFESLHGVSKIKDGYNPATWMLE
VTTTSQEQILGVDFSDIYKKSELYQRNKALIKELSQPAPGSTDLHFPSKYAQSSITQCVA
CLWKQNLSYWRNPPYNTVRFFFTTIIALLLGTIFWDLGGKTYTSQDLMNAMGSMYSAVLF
IGVMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYALAQDILYGVIVYSM
IGFEWTAAKFFWYLFFGYFTLLYFTFYGMMAVGLTPNYHIAAIVSSAFYAIWNLFSGFII
PRPKVPIWWRWYCWICPVAWTLYGLVVSQFGDVMTPMDDGRAVKVFVEDYFDFKHSWLGW
VAAVVVAFAVLFATLFGFAIMKLNFQKR*

Other information
Ka divergence:0.116764KaKs divergence:0.691807
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):4353Length 2 (bp):2067Length divergence:-0.356
MFE 1 (kcal):-1591.83MFE 2 (kcal):-702.02MFE divergence-0.388