Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G143205-GRMZM2G152661
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193150
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.4575079405603
Log2 mRNA fold difference:-1.497155779238
Log2 TE fold difference:0.040843404560099
Sequences
Protein sequence

MSQSFDINVLREEARSRWLKPSEVYYILQNHERFPITHEAPKKPPSGSLFLYNRRVNRYF
RRDGHTWRRKKDGRTVGEAHERLKVGNVDSLSCYYAHGEQNPCFQRRCFWMLEPAYEHIV
LVQYREVAEGRYYSSQLSNGPPEPLSSLGYPNAICGNQYHRSTSGTSEGSESHQSYSNLS
SVTEVSSYSGNKEYNKNDGSLLSIPEVGHTCQQNQTGNGNSKNKSELNMALKKIAEQLSL
GEDDDDDYIYSNQTHSMGGDNQIKQIRQEGTQKGLSRNIAPSWEDVLHSSSGLPTSSIYQ
QSDVKYQKKSEYQPPEILDSSDLRIQLSATKRFLLGPEASIDSPSLNSVLRNRVNSVTDT
ISAYDSRFESSLNPDWQTKTALTFQSNSQGSEITELFDHDHFEPYSREDTTISLGQTNKF
NIREVSPEWAFSYEITKVIITGDFLCDPSNLCWAVMFGDNEVPVEIVQPGVLRCHTPLHS
NGNLRICITSGNREVCSEFKDFEFRSKPTSSSFTDIAPSSRHLKSSEELLLLAKFARMLL
SGNGNREVPDGDPQSGQCPKLKTNEELWDRLINELKVGCENPLSSVDWIVEQLLKSNLQQ
WLSVKLRGFNGTDFLSKQEQGIIHLISALGYEWALSPVLSAGVGLNFRDSNGWTALHWAA
YFGREKMVAALLAAGASATAVTDPTAQDPVGKTAAFLASERGHTGLAGYLSEVSLTSYLA
SLTIEESDVSKGSAEVEAERAVEGISQRNAQRHGGTEDELSMKDSLAAVRNAAQAAARIQ
NAFRAFSFRKRQQKTARLRDVYGMTQEDIDELAAASRLYHQAHASSGQFYDRAAVSIQKK
YKGWKGRKHFLNMRRNAVKIQAHVRGHQVRKKYRTIVSTVSVLEKVILRWRRKGHGLRGF
RAEQQPMVEAIEEDDEEDDDFDDDEAVKVFRRQKVDQAVKEAVSRVLSMVDSTEARMQYR
RMLEEFRQATAELEGSNEVTSIFDSDLELLGINNFM*

MGFNRILTNGAPIGLFFGGSLFLYNRRVNRYFRRDGHTWRRKKDGRTVGEAHERLKFFVH
VFLQTWSKHSHRKQGRCRIPWPRVIVPNCGSGSPWVIVPNARESLLQHSHDARTCVSVGQ
VEFHGCFRLSQMNAYYGALGAFGQVGNVDALSCYYAHGEQNPSFQRRCFWMLEPAYEHIV
LVQYREVDVVRNYSSQLSNGLPEPLSSLGYPNAICGNQYHSSSSGASECSESHQSYSNLS
SVTEVSSYSGNKEYTKNDGGLLSIPEVGHTCLQQNRTDNGNSKNKSGLNIALKKIAEQLS
LGEDDDDYIFSNQAHSVGGDNQVKHIQQEGTQKGLSRNIAPSWEDVLQSSSGLPISSIYQ
QSDVEYQKNSEYHPPERLDSSDLRIQLAAAKKFLLGPEATVDSPSLNSVLRNRANCVTDT
ISAYDSRFGSSLNPDWQTKTALTFQSNSQGSEITELFDHGHFEHYSREDTTFSLGQTNKF
NIREISPEWAFSYEITKVIITGDFLCNPSNLGWAVMFGDSEVPAKVVQPGVLLCHTPLHC
SGNLRICITSGNREVCSEFKDFEFRSKPSSSFTDIAPSSRHLKSSEELLILAKFARMLLS
GNGNPEVPDGDPQSGQCPKLKMDEGLWDRLIEELKVGCESPLSSVDWILEELLKSKLQKW
LSVKLRGFNGTDSISKHDQGIIHLISALGYEWALSSVLSVGVGLNFRDSNGWTALHWAAY
FGSCSFRRNTKVAKVATFLNMRRNAVKIQAHVRGHQVRKKYRTIVSTVSVLEKVILRWRR
KGHGLRGFRAEQQSMVEAIEEDDEEDDDFDDDEAVKIFRRQKVDQAVKEAVSRVLSMVDS
TEARMQYRRMLEEFRQATNWKDQMK*

Other information
Ka divergence:0.326488KaKs divergence:0.288685
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2991Length 2 (bp):2598Length divergence:-0.07
MFE 1 (kcal):-925.72MFE 2 (kcal):-796.35MFE divergence-0.075