Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G143234-GRMZM2G157758
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283198
Function (paralog2):ATP synthase subunit epsilon, mitochondrial (ATPase subunit epsilon)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7614323569047
Log2 mRNA fold difference:-2.6327494448357
Log2 TE fold difference:0.92997365208884
Sequences
Protein sequence

MSATTAAVPFWRAAGMTYIGYSNICAALVRNCLKEPFKSEAASREKVHFSISKWTDGKQE
KPKYSVYRVEFVMGDRMGKAARDNLKNHIFRICASEYEPELCSVCIAFRYFFNANLVLSA
AVRTESDE*

MSATTAAVPFWRAAGMTYIGYSNICAALVRNCLKEPFKSEAASREKVHFSISKWTDGKQE
KPTVRTESDD*

Other information
Ka divergence:-0.193537KaKs divergence:-0.791817
GC content 1 (%):50GC content 2 (%):60GC content divergence:0.091
Length 1 (bp):387Length 2 (bp):213Length divergence:-0.29
MFE 1 (kcal):-135.4MFE 2 (kcal):-80.8MFE divergence-0.253