Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G143242-GRMZM2G175188
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384016
Function (paralog2):hypothetical protein LOC100279078

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.36722281946444
Log2 mRNA fold difference:0.039876321144907
Log2 TE fold difference:0.31374148469986
Sequences
Protein sequence

MASEAARRRQEVAVEGQRHLEETIAAAFQILVSMNDELCNAGLWSSSSVSAAAAAAASAG
SQHHQSATPPPPHSADSDAADAGGAPGPGGSLDEARHRYKSAVVALRDSISAVSSCPQDI
GSTESEVDQAEIERLEEHASALRKEIESKNKQVKLLMDQLRDLITDVAMWQSPCSV*

MASEAARRRQEMAEEGQRHLEETIAASFQILVSMNDELCNAGLWSSSSVSATAAAGYQHH
HSATLPTPHSVDSDAADAGGAPSPGGSLDEARHRYKSAVAALRASISAVSSCAQDIGSTE
SEADHAEIERLEEHASALRKEIESKNKQVKLLIDQLRDLIADIAMWQSPCSV*

Other information
Ka divergence:0.440509KaKs divergence:0.394234
GC content 1 (%):61GC content 2 (%):59GC content divergence:-0.017
Length 1 (bp):531Length 2 (bp):519Length divergence:-0.011
MFE 1 (kcal):-233.8MFE 2 (kcal):-208.4MFE divergence-0.057