Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G143512-GRMZM2G144083
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100274413

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1466502941905
Log2 mRNA fold difference:-1.2547585305768
Log2 TE fold difference:0.10778798040897
Sequences
Protein sequence

MAASTRALFLSCFHGGGGAEVSRHLALRPRYPSNPRRPRSAVVAGEGGEGGGSGGDLEAA
KGTADRDEEEKVSVFAVTGMTCAACAGSVEKAVKRLPGIHDAAVDVLGGRAQVVFYPAFV
SEGKIREAIEDVGFEAKLINEEVRAKNILVCRFHIKGMTCTSCTNTVESALQAFPGVQRA
SVALATEEAEIHYDRRIVTASQLIHAVEETGFEAILITTGEDRSRIDLKLDGVLSERLTM
ILKSSIQALPGVEDIKIDTELHKVTVSYKPDQTGPRDLIEVIESATSGGVTASIYAEAGG
REHHRYGEIKRYRQSFLWSLIFTIPVFLTSMVFMYIPGLKDGLEKKVINMMSIGELLRWI
LSTPVQFVIGRKFYTGAYKAICHGSPNMDVLIALGTNTAYFYSVYSVLRAATSENYMSTD
FFETSSMLISFILLGKYLEILAKGKTSEAIAKLMDLAPETATLLMYDYEGNVVGEKEIDS
RLIQKNDVIKVVPGGKVASDGFVIWGQSHVNESMITGESRPVAKRKGDTVIGGTVNENGV
LHVRATFVGSETALAQIVRLVESAQMAKAPVQKFADQISRVFVPLVIVLSLLTWLVWFLA
GRFHGYPYSWIPSSMDSFQLALQFGISVMVIACPCALGLATPTAVMVATGVGASQGVLIK
GGQALESAQKVNCIVFDKTGTLTVGKPVVVNTRLLKNMVLREFFDYVAAAEDNSEHPLAK
AIVEHAKKFYSEENHIWPEARDFISVPGHGVRAKVCDRSVIVGNKSFMLSSSIDIPVEAS
EILMEEEEKAQTGIIVAMDQEVVGIISVSDPIKPNAREVISYLKSMNVESIMVTGDNWGT
ANAIGKEVGIEKIIAEAKPEQKAEKVKELQLLGKTVAMVGDGINDSPALVSANVGLAIGA
GTDVAIEAADIVLMKSNLEDVITAIDLSRKTFFRIRMNYVWALGYNVIGIPIAAGVLFPS
TRFRLPPWVAGAAMAASSVSVVCWSLLLRYYKSPKKFDN*

MVATTRRALFLSCFHGGSEMSPRLSLRPRYPSMPRRPKGVAAAGGGGNGDLEAAVGTGDD
EEEKVAVFSVSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFYPAFVSENKITE
AIEDVGFEAKLIDEEVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATE
EAEIRYDRRIISASQLIQAVEETGFEALLVTAGEDQSRIDLKMDGVLDERLIMILKSSIQ
ALPGVENVKFNSELHKVTVSYNPDHTGPRDLIEVIKAATFGHVNASIYLEADGRDQHRYG
EIKQYRQSFLWSLIFTIPVFLTSMVFMYIPWLKDGLEKKVVNMMSIGELLRWILSTPVQF
VIGRKFYTGAYKAMCRGSPNMDVLIALGTNTAYLYSVYSVLRAATSGNYMSTDFFETSSM
LISFILLGKYLEILAKGKTSEAIAKLMDLAPETATLLVYDYEGNVVGEKEIDSRLIQKND
VIKVVPGGKVASDGFVIWGQSHVNESMITGESQPVAKRKGDTVIGGTVNENGVLHVRATF
VGSESALAQIVRLVESAQMAKAPVQKFADHISRVFVPLVILLSMVTWLAWFVAGRLHSYP
QSWIPRFMDSFQLALQFGISVMVIACPCALGLATPTAVMVATGVGASHGVLIKGGQALES
AQKVDCIVFDKTGTLTIGKPVVVDTRLLKNMVLREFYDYAAAAEVNSEHPLAKAIVEHAK
KLRPEGNHMWPEAREFISVTGQGVKAEVSGKSVIVGNKGLMLSSGIGIPLEASEILVEEE
GKARTGIIVAVDREVAGVISVSDPTKPNALQVISYLKSMNVESIMVTGDNWGTANAIGRE
VGIEKIIAEAKPEQKAERVKELQLSGRTVAMVGDGINDSPALVSADVGLAIGAGTDVAIE
AADIVLMKSNLEDVVTAIDLSRKAFFRIRMNYVWALGYNVVGIPIAAGVLFPSTGFRLPP
WVAGAAMAASSVSVVCWSLLLRYYKAPKIAGTAKEIGITTL*

Other information
Ka divergence:0.23664KaKs divergence:-0.956758
GC content 1 (%):49GC content 2 (%):52GC content divergence:0.03
Length 1 (bp):3000Length 2 (bp):3006Length divergence:0.001
MFE 1 (kcal):-1052.27MFE 2 (kcal):-1154.37MFE divergence0.046