Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G143655-GRMZM2G180558
Species:maize
Duplication type:WGD
Function (paralog1):PYM protein
Function (paralog2):hypothetical protein LOC100273358

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.8882767754344
Log2 mRNA fold difference:-1.2797808914306
Log2 TE fold difference:-1.696238429626
Sequences
Protein sequence

MATSSDGGGDQRRLLSIPKEGERIIAPTRRPDGTLRKAIRIRAGYVPQEEVAIYQSKGAL
MRKSGPDVPPGYDPALVADAKPKTKAAKRNERRKEKRQQQASLANDKGKSMNIEGTDAGE
TDKVLSSKTDKQKDSVESVTKQMSGIAISESHAMPSTNTINNSQPESSAPDIDKKIRALK
KKIRLAEAQVQGDPEKLKSETLEKIKKIDGWCMELKLLEDSRAPAA*

MATYSDGGGDQRRLLTIPKEGERIIAPTRRPDGTLRKAIRIRAGYVPQEEVAIYQSKGAL
MRKSGPDVPPGYDPAQVADAKPKTKAAKRNERRKEKRQQASSTNNKGKSMDIEGTDAGET
DKALSSKTVKQKDSVESVIKQISGIAISESHATPSTNTTNNSQPESSAPDIDKKIRALKK
KIRLAEAQVQGDPEKLRLEALEKMKKIDGWLKELKLLEDKRAPAA*

Other information
Ka divergence:0.138569KaKs divergence:-0.238337
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):681Length 2 (bp):678Length divergence:-0.002
MFE 1 (kcal):-224.73MFE 2 (kcal):-222.98MFE divergence-0.004