Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G143955-GRMZM2G102878
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191192
Function (paralog2):LOC100284340

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLRCHTPPQCARAPLRHHGRWESPPAAAPAVVVRCARGAPQVSGIEAASPGHAAVTAALA
KAEGGDARPSLAERLRLGNLLEDGLSYKESFIVRCYEVGINKTATVETIANLLQEVGCNH
AQSVGFSTDGFATTTTMRKLGLIWVTNRMHIEIYKYPAWGDVVEIETWCQEDGRIGTRRD
WILKDLANGEVIGRATSKWVMMNQNTRRLQRVSDDVRDEVFMHCPKAPRLAFPEENNGSL
KKIPNLSDPAEYSRLGLVPRRADLDMNQHVNNVTYIGWVLESIPQDIIDTHELQTITLDY
RRECQQDDIVDSLTCIEEGEEKSMNGSASAAAPHKEERQQFLHCLRFAANGHEINRGRTV
WRKLAR*

MKAGRYEVDGYVYSAAEEPKIMITGKWNKSLSCQPCDQEGDPLPGTELKEIWRVAPAPQG
DKYQYTQFAHKINSFDTAPKKLLASDSRLRPDRYALEKGDMSKSGAEKSSLETLPELKEL
CRADVLHLSRGVMPPMCSTQNPRNLRLSYLCHSQWCTQLDNDINPTRSRSTKNLEWARRE
GRAFSHLVSGIEAASPDHAAATAVAAKAEGGDARPSLAERLRLGSLLEDGLSYKESFIVR
CYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLGLIWVTNRMHIEIY
KYPAWGDVVEIETWCQEDGKIGTRRDWILKDLSTGEVTGRATSKWVMMNQNTRRLQRVSD
DVRDEVFIHCPKTPRLAFPEENNGSLKKIPNLSDPAQYSRLGLVPRRADLDMNQHVNNVT
YIGWVLESIPQDIIDTHELQTITLDYRRECQHDDIVDSLTYVEEGEERSMNGSASSVPHT
EQRRQFLHCLRFAANGDEINRGRTREINKVHDKKEARAMEEAWRSASVGSYRGSDDDAEL
QVAMCVSRDKEELRRHARASSGTYEICGGSSQGVVRVAFGRTPSKKEKPQMV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):50GC content divergence:-0.029
Length 1 (bp):1101Length 2 (bp):1779Length divergence:0.235
MFE 1 (kcal):-416.2MFE 2 (kcal):-623.47MFE divergence0.199