Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G144030-GRMZM2G113696
Species:maize
Duplication type:WGD
Function (paralog1):Eukaryotic translation initiation factor 5A (eIF-5A)(eIF-4D)
Function (paralog2):Eukaryotic translation initiation factor 5A (eIF-5A)(eIF-4D)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSDSEEHHFESKADAGASKTYPQQAGTVRKNGFIVIKNRPCKVVEVSTSKTGKHGHAKCH
FVAIDIFNGKKLEDIVPSSHNCDIPHVNRTEYQLIDISEDGFVSLLTSDGNTKDDLRLPT
DETLVAQIKEGFESGKDLVVTVQSAMGEEQICALKDVGPK*

MSDSEEHHFESKADAGASKTYPQQAGTVRKNGFIVIKNRPCKVVEVSTSKTGKHGHAKCH
FVAIDIFNGKKLEDIVPSSHNCDIPHVNRTEYQLIDISEDGFVSLLTSDGNTKDDLRLPT
DETLVAQIKEGFESGKDLVVTVQSAMGEEQICALKDVGPK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):483Length 2 (bp):483Length divergence:0
MFE 1 (kcal):-162MFE 2 (kcal):-164MFE divergence0.006