Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G144146-GRMZM2G370815
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278838
Function (paralog2):hypothetical protein LOC100381453

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.2031834459718
Log2 mRNA fold difference:-1.7224307770385
Log2 TE fold difference:0.67838512205333
Sequences
Protein sequence

MAETGESSPNPAAAPEDTHHEGSEVPAAAVAAVHAQPQLQPQPRPPPQPSKVRLMVSYGG
RIQPRPHDNQLAYVNGETKILSLERPVLFADFAARLTTLVGNARDVCVKYQLPGEDLDAL
ISVTNDEDLEHLVVEYDRAHNNGPAAGSGSGRGGATPRLRVFLFPVQPPPPPPPAGLLEP
KADQRLYIVEALNTVSLPSSKLDPPPVPSHQSSPPQQQKRESVFAQQSSSPPPPPPQAKH
EAVFVQQAPPQPQTAFQMPPPPQPSHVVLTAAGPDYLFGLDNGFVPPPAVKVKDPAGDPP
TVRENVPVEIPAKNDDRHPNPAGDHVAVSPVVSPAEYQRQIQELEKLQVADNATHQPPPP
ATAPAPTHGPVPAALPRNGSDDSLARAYPPVTATPTSNAEYYIPKFPEKPPVPPLSSAPP
PTTYVQVQGRYASVAPGSGADHAPVFFIPAPHGYFAAAASPGATSYPAVYAVAPPSATAN
GSAPSAVVSNATAYAPAPTQVAYDSNGRAIYYTSMLPQYPSAVNGMSAPGGVLGTEPAKQ
VAVKPTVS*

MAESGESSPNSAAATDDTHHEMPEAGAAAAAVHAQPRPPPPPSKVRLMVSYGGRIQPRPN
DNQLAYVNGETKILSLERPLCFPDFAARLAALVGNAADVRVKYQLPGEDLDALVSVTNDE
DLEHLVHEYDRLHVHRHATASSAGSSRGGSAPRLRVFLFPVQSPPPPPQPAGILEPKVEQ
RQWFVDALNTVLLPSSKQDPPPVPPQQQKQEQESVFAQQSPPPQAKHEAVFVQQSPPQPQ
TVVQMQMPPPQHVVLAAASPDYLFGLDNGFVHPPAVKVKDPAGDPPAVRESVPVELPAKN
EDRHPIPNPAGDNVAVSPAEYQRQIPGLEKLQVADNAAHQPPPPAPAPAPAPSLAPTPVP
AALPRNGSDDSLTRGYPLATPTPNSSAEYYLPKFPEKPPVPPPPQSSAPPPPTYLQVQGR
YTSVAPGSGADRGPVFFIPAPHGYFAATASPGATSYPAVYAVAPPSTAANGSAASPAASN
ATAYSPAPTQVAYDSNGRAIYYTSMLPQYPSAVNGMSSAGAVLGTEPVNPVAVKPTVS*

Other information
Ka divergence:0.0195631KaKs divergence:-0.0896728
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):1647Length 2 (bp):1617Length divergence:-0.009
MFE 1 (kcal):-731.02MFE 2 (kcal):-726.8MFE divergence-0.003