Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G144346-GRMZM2G114137
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):CCT motif family protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTNAGAATGAALGARTARSCDSCMRRRARWHCPADNAFLCQSCDVSVHSANPLARRHHRV
RLPSASCSSPPRDPDAPTWLHGLKRRPRTPRSKPGGSNKHEAAPSSIAAAASAAVPDLEA
EAEAEAEESGSGILGDNDDDHGFQDDDENLLYCVPVFDPMLAEFYNPVADEGEQKPACLM
LPLVETSPEFASGGLAEADGLSGFDVPDMDLASFAADMESLLMGVDDGFDDLGFLDEQKP
QVNADVDLEAMAAPEPEREDKKRKRDGFDYLGFLDEEKPQVNADVDLEAMVAPEPEREDK
KRKRTDMILKLNYEGVIASWVRDGGSPWYHGERPHLDDPYELWLEFPATGSRGLFGGTMT
AVTGGEREARVSRYREKRRRRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTTLPPLPRPPP
PSQQQQKKKQLPRSLPHVGMVLAPPPGADGRFRF*

MTSAGAATGAALGARTARSCDGCMRRRARWHCPADDAFLCQTCDVSVHSANPLARRHHRV
RLPSASCSSPPRDPDAPTWLHGLKRRPRTPRSKPGGSKSNKHEATPSFIAAAASSAAVPD
LEAEESGSGILGGNDDHHGFLQDDDEDLLYRVPVFDPMLAEFYNPVADEGEQKPACSLLM
PSLAETSPEFASGGSAEADGLSVSFHVPDMELASFAADMESLLMGVDDDGFDCLGFLDEE
KPQVNADLDAIVAPAPEPEDKKRKRPEMILKLNYEGVIASWVRDGGSPWFHGERPHLDCH
ELWSDDFTTGSRELLGGAVTPVTGGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRP
RMKGRFVKRATLPPLPRPPPPQQQQQQKQLPRAPPHVGMVLPPPPVSNGRLWF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):68GC content divergence:0.015
Length 1 (bp):1365Length 2 (bp):1242Length divergence:-0.047
MFE 1 (kcal):-662.5MFE 2 (kcal):-615.16MFE divergence-0.037