Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G144744-GRMZM2G024973
Species:maize
Duplication type:WGD
Function (paralog1):DELLA protein DWARF8 (Protein dwarf-8)
Function (paralog2):Dwarf plant9 Fragment

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MKREYQDAGGSGGDMGSSKDKMMAAAAGAGEQEEEDVDELLAALGYKVRSSDMADVAQKL
EQLEMAMGMGGVGGAGATADDGFVSHLATDTVHYNPSDLSSWVESMLSELNAPPAPLPPA
TPAPRLASTSSTVTSGAAAGAGYFDLPPAVDSSSSTYALKPIPSPVAAPSADPSTDSARE
PKRMRTGGGSTSSSSSSSSSMDGGRTRSSVVEAAPPATQASAAANGPAVPVVVVDTQEAG
IRLVHALLACAEAVQQENFSAAEALVKQIPMLASSQGGAMRKVAAYFGEALARRVYRFRP
PPDSSLLDAAFADLLHAHFYESCPYLKFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQW
PALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYRGLVAAT
LADLEPFMLQPEGDDTDDEPEVIAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTVVE
QEANHNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGR
QICNVVACEGAERTERHETLGQWRSRLGGSGFAPVHLGSNAYKQASTLLALFAGGDGYRV
EEKDGCLTLGWHTRPLIATSAWRVAAAAAP*

MKREYQNAGGNDGYRGSSKDKSMAAAAGAGEQEEEVDELLAALGYKVRSSDMADVAQKLE
QLEMAMGMGGACPTADDGFVSHLATDTVHYNPSDLSSWVESMLSELNAPPPPLPPATPAP
RLASTSSTVTSGAAAGAGYFDLPPAVDSSSSTYALKPIPSPVAAASADPSPDSAREPKRM
RTGGGSTSSSSSSSSSMDGGRTRSSVVEAAPPATQAANGPAVPVVVVDTQEAGIRLVHAL
LACAEAVQQENFSAADALVKQIPVLASSQGGAMRKVAAYFGEALARRVYRLRPAPDGSLL
DAAFADLLHAHFYESCPYLKFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQAL
ALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYRGLVAATLADLEPF
MLRPEGGGDTDDEPEVIAVNSVCELHRLLAQPGTLDKVLGTVRAVRPRIVTVVEQEANHN
SGTFLDRFTESLHYYSTMFDSLEGAGSGSGSGSGSGQPTDASPPAGTDQVMSEVYLGRQI
CNIVACEGAERTERHETLVQWRGRLGGSGFEPVHLGSNAYKQASTLLALFAGGDGYRVEE
KDGCLTLGWHTRPLIATSAWRVAAP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):1893Length 2 (bp):1878Length divergence:-0.004
MFE 1 (kcal):-1000.73MFE 2 (kcal):-979.94MFE divergence-0.01