Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G144995-GRMZM2G110233
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283975
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL
NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF
VQELLRGVRLHFDRFINELKDSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
LDKDINSFSMRVREWFSWHFPELVKIVNDNYLYAKLAKFIVNKSDLTEKDIPALADIVGD
EDKAKEIVEAAKASMGQDLSPVDLINVQQFAQRVMNLSEYRKNLYEYLVTKMNDIAPNLT
SLIGEVVGARLISHAGSLSNLAKCAASTLQILGAEKALFRALKTRGNTPKYGLIFHSSFI
GRASTKNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKN
LDVMKAAIDSMVNGTSMDDDDIEKTDASPKKSKKKKTKTKADGDAMDVDKPSNVAGGEAE
PGTEKKKKKKKHKLEEEAQEENGAADTTPKKKKKKSREASEEAEPKTATDGKKKKKKKAK
AEDDE*

MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL
NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF
VQELLRGVRLHFDRFINELKDSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
LDKDINSFSMRVREWFSWHFPELVKIVNDNYLYAKLAKFIVNKSDLAEKDIPALADIVGD
EDKAKEIVEAAKASMGQDLSPVDLINVQQFAQRVMNLSEYRKNLYEYLVTKMNDIAPNLT
SLIGEVVGARLISHAGSLSNLAKCAASTLQILGAEKALFRALKTRGNTPKYGLIFHSSFI
GRASTKNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKN
LDVMKAAIDSMVNDTLMDDDGKADNEKADTSAKKSKKKKTKTETDGDAMDVDKPSNVADG
EAELGTEKKKKKKKHKLEEAQEENGAAHANGDAEETQTPKKKKKKSREISEEAEPKTATE
GKKKKNEEAEPKTATEGKKKKKKAVKADE*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1638Length 2 (bp):1710Length divergence:0.022
MFE 1 (kcal):-542.22MFE 2 (kcal):-559.87MFE divergence0.016