Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G145101-GRMZM2G414528
Species:maize
Duplication type:WGD
Function (paralog1):carbonic anhydrase
Function (paralog2):hypothetical protein LOC100272439

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.76598249205539
Log2 mRNA fold difference:0.65257686262255
Log2 TE fold difference:0.11295807946316
Sequences
Protein sequence

MPRTALLRLAAASTRASSAPAARRLYSSSHSHGHGSEEHAITREDEQLPPPPHGPDPGVR
RLPRRRGEHRRELLSVTMASRDHTGLTRQLLDFQHDTIDEVGAGHDPFIDLKARFMDFKQ
RNYVEKFSNYQTLAEQQTPKFMVVACADSRVCPTAVLGFQPGEAFTVRNVANLVPPYEHG
GTETSAALEFAVNTLQVENVLVIGHSRCGGIQALMSMKDDSTSGSFIKNWVSIGKSARLS
TKAAAGNMSFDIQCKHCEKESINSSLLNLLTYPWIEKRVNEGTLNLHGGYYNFVDCTFEK
WTLLYREGLEGGSKYAIKNRSTWC*

MASGVLHRSASRCLRPAAAPTPDSGRGHGAVMIGDSGTRGVALRLGGSSRRELLSVTMAS
RDHTGLTRQLLDFQHDTIDEVGAEHGPFMDLKARFMDFKQRNYVENFSNYQNLAEQQTPK
FMVIACADSRVCPTAVLGFQPGEAFTVRNVANLVPPYEHEGSETSAALEFAINTLEVENV
LVVGHSRCGGIQALMSMKDDSTSGSFIKNWVSIGKSARLSTRAAAGNLSFDMQCKHCEKE
SINSSLLNLLTYPWIEKRVNEGTLNLHGGYYNFVDCTFEKWTLLYREGLEGGSKYAIKNR
STWS*

Other information
Ka divergence:0.264004KaKs divergence:-0.044611
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):975Length 2 (bp):915Length divergence:-0.032
MFE 1 (kcal):-325.11MFE 2 (kcal):-299.31MFE divergence-0.041