Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G145104-GRMZM2G051792
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384569 (LOC100384569), mRNA
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAEMAERSVAGELPEEPRPPHGEEDDEEEEEGDVCRICRNRGDEDHPLRYPCACSGSIKF
VHQDCLLQWLDHSNSRQCEVCKHAFSFSPVYADNAPTRLPFQELIVGVGMKACHVFQFIL
RLAFVLSVWLMIIPFITYWIWRLTLVRSIGEAQRLFLSHISAQLILSDCLHGFLLSAIIV
LIFLGATSLRDYIRHLRELGGHDAERDDGGRERHGARAVRRLAGPNNRVPADGNIDELAE
AQGIGAGELLRRNAENVAARLERLEAQVEQMLDGLDDADGAEDVPFDELVGMQGPVFHLV
ENAITVLASNAIFLIVVIFVPFSLGRIVLYYLSWFFSSASTPMLAKMMPFTETAISIAND
TLKSALNVVKNFSSDSNNEGVIGHVIEVVTQSLKINATGLSVIQVTGKSSLMKGTAIGSS
YLSDLTTLAVGYMFIFCLVLLYIGSLALLRYARGERFTIGRLYGIATILEAIPSLCRQFF
AGMKHIMTMVKVAFLLVIELGVFPLMCGWWLDVCTLKMLGTTIAQRIEFFTVSPLASSSI
HWLVGIVYMLQISIFVSLLRGVLRNGVLYFLRDPADPNYNPFRDLIDDPVHKHARRVLLS
VAVYGSLIVMLVFLPVKLAMRVAPSIFPLDITIFDPFTEIPVDVLLFQICIPFAIEHFKP
RATIKSLLHHWFAVVGWGLGLTDFLLPKPEENGGQENWNGRAERRDRGHGGQEMVAPQVE
QLMIQHVAAEHNDRGNANEANDVTEESDVDDQGDSEYGFVLRIVLLLVLAWMTLLIFNAG
MIVIPISLGRLVFEGVPRLPITHGIKCNDLFSFSIGCYIL*

MAEIAERAVAGEVPEEPRPPHGEEDDEGEEEGDVCRICRNHGDEDHPLRYPCACSGSIKF
VHQDCLLQWLDHSNSRQCEVCKHAFSFSPVYADNAPTRLPFQELMVGVGMKACHVFQFIL
RLAFVLSVWLMIIPFITYWIWRLTFVRSLSEAQRLFLSHISAQLILSDCLHGFLLSAIIV
LIFLGATSLRDYIRHLRELGGHDAERDDGGRERHGARAVRRLAGPNNRVPADGNVDELAE
AQGIGAGELLRRNAENVAARLERLEAQVEQMLDGLDDADGAEDVPFDELVGMQGPVFHLV
ENAITVLASNAIFLIVVIFVPFSLGRIILYYLSWFFSSASTPMLAKVMPFTETAISIAND
TLKSALNVVKNFSSDSNNEGVIGHVIEVVTQSLKINATGLSVIQGTGKNSLMKGTTIASS
YLSDLTTLAVGYMFIFCLVFLYIGSLALLRYARGERFTIGRLYGIATILEAIPSLCRQFF
AGMKHLMTMVKVAFLLVIELGVFPLMCGWWLDVCTLKMLGTTIAQRVEFFTMSPLASSSI
HWLVGIVYMLQISIFVSLLRGVLRNGVLYFLRDPADPNYNPFRDLIDDPVHKHARRVLLS
VAVYGSLIVMLVFLPVKVAMRVAPSMFPLDITIFDPFTEIPVDVLLFQICIPFAIEHFKP
RATIKALLHHWFSVVGWGLGLTDFLLPKSEENGGQENLNARAERRDRGHGGREMVAPQVE
QLMIQHVAAEDNGRGDSNEANDVTEDSDVDDQGDSEYGFVLRIVLLLVLAWMTLLIFNAG
MIVFPISLGRLVFEAVPRLPITHGIKCNDLFSFSIGCYILWSVAAGTRYAIDYITSRQLG
FLVQQICKWCSIVLKSSVLLSIWIFVIPVLIGLLFELLVIVPMRVPIDESPVFLLYQDWA
LGLIFLKIWTRLVMLDQMAPLVDESWRSKFERVRDDGFSRLKGLWVLHEIIMPIVTKLLT
ALCVPYVLARGIFPLLGYPLIVNSAVYRFAWLGSLIFSALFFWGKRFHVWFTNLHNSIRD
DRYLIGRRLHNFGEDSHSPERSESGASIGSDDQDRDIVLRDQEEEVGLRMRRNNMHANQQ
PRFAL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):2463Length 2 (bp):3258Length divergence:0.139
MFE 1 (kcal):-833MFE 2 (kcal):-1084.84MFE divergence0.131