Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G145346-GRMZM2G082372
Species:maize
Duplication type:WGD
Function (paralog1):wiscott-Aldrich syndrome, C-terminal
Function (paralog2):wiscott-Aldrich syndrome, C-terminal

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSREQPSPAPAQRRFIAIPSFSSSGCRSHSSVDVVDTARHAGNGKKPHPQGAETGAVPGG
ASAGGKGESLVARLLRGFKNLSQIFAVYEDEEEEEEREMVIGLPTDVKHVAHIGWDGSTS
TTSSLRSWNRAAPPPPASSSSSAPAAAAPKEQEQYPLPLPALSMQQFELAMAAQAGGGGG
GAAHRRHS*

MSREQQMPRRRFIAIPFSSGCRSHSSVDVVDTGRLAGDGKKPHPQGAEAGAAAAAARGKG
ESLVARLLRGFKNLSQIFAVYDEEEEEEREMVIGLPTDVKHVAHIGWDGATSTSSNLRSW
NRPAPPPPASSFSAPQQRPQEQYPLPLPALSMRQLELAMGAQAQAAGGATTAAHRRHS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):72GC content 2 (%):71GC content divergence:-0.007
Length 1 (bp):567Length 2 (bp):537Length divergence:-0.027
MFE 1 (kcal):-309.5MFE 2 (kcal):-287.4MFE divergence-0.037