Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G145376-GRMZM2G417658
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277826 (LOC100277826), mRNA
Function (paralog2):hypothetical protein LOC100275773

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.2247324076326
Log2 mRNA fold difference:-0.092642166895856
Log2 TE fold difference:-1.1093022592631
Sequences
Protein sequence

MADEALDQPPDAAPSPSLAPATPPAPATSSPAALLRPRREAFEHGLLPIPKLIFPEGMLA
QTLAQLKEKLAASVPDGRVRAAALAEALQIPQEQAALALGTLAAVLPAEDPVLGDGAMDG
AAADIRDVLLFLYIQSYKRLVPRSAHKDSPAVADVWPSTSAFDGYLSALSPIQLVRSNSR
RFMPSQADEEIHQLSFLQKHMANILTLLADSVEGEGDDSLVLTMETFEHLGFLVQFSEGT
SLSQAATFFANSDPDMPAVPVPAAQVLDWMSQNIAFSLEYSSERSVAKESNQQTMSDLDV
TMAEANTSHSRNSTPSANPAYYRNVTFVEGFSKTSVVKHASDVKGNSIKVLNCHDSVIYI
LAPLKYATVYGCSDATVVLGAVGKVVKVEHCERVHIIAAAKRICIANCRECIFYLGVNHQ
PLVLGDNHKLQVAPFNTCYPQLQDHMMQVGVDPSVNKWDQPFVLGVVDPHDSLSHPAGVA
DVKAESATCLDPDLFTSFLIPSWFGDEGQEPINCNPFPLPEIYEAFQSKKRSALEDIQKM
IRELQLDENRKRELAAALHAQFKDWLYASGNIRQLYCLQGD*

MADEALDQPPDATPSPTPATPPVPATPSPTVLLRPRREAFEHGLLPIPKLIFPEGTLAQT
LAQLKEKLAASAPDGRVRAAALAEALQIPQEQAALALATLAAVLPAEDPALGDGAVDGSA
ADIRDMLLFLYIQSYKRLVPRSAHKDSPVVADVWPSTSAFDGYLSALSPIQLVRSNSRRF
MPSQADEEIHQLSYLQKHMANILTLLADSVEGDGDDSLVLTMETFEHLGFLVQFSEGTSL
SQAATFFACSDPDMPDVPVPAAQVLDWMSQKIAFSLEYSAERSAAKESNQQTMSDLDVTM
AEANTSHPRNSTPSANPAYYRNVTFVEGFSKTSVVKHASDVKGNSIKVLNCHDSVIYILA
PLKYATVYGCSDATVVLGAVGKVVKVEHCERVHIIAAAKRICIANCRECIFYIGVNHQPL
VLGDNHKLQVAPFNTCYPQLHEHMIQVAVDPSVNKWDQPFVLGVVDPHDSLSHPAGVSDV
KAESATCLDPDLFTNFLIPSWFGDERQGTTNRNPFPLPEIYGTSQSKKRSALEDIQKMIR
ELQLDENRKRELATALHVQFKDWLYASGNIRQLYCLQGD*

www.000webhost.com

Other information
Ka divergence:0.142292KaKs divergence:0.0633413
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):1746Length 2 (bp):1740Length divergence:-0.002
MFE 1 (kcal):-640.98MFE 2 (kcal):-617.36MFE divergence-0.019