Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G145655-GRMZM2G440009
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384603
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.80620393116031
Log2 mRNA fold difference:-0.53044852563314
Log2 TE fold difference:-0.28036629386914
Sequences
Protein sequence

MTAKVHPNVAVPSVGLGQPAAVAVAVSPPADEEPVTLTVWRKSLLFNCRGFTVFDARGDL
VYRVDTYASDSRAEVVLMDAAGRPVLTVRRRQRPIGLGLGADQWLVYPGEEARRLPPLYA
VKRPAAQYMRGGGGGAKSMAHVAASSGGAGAGGGGYEVEGSYLRRRCTVYDERRRAVAEV
RPKEAVGSDVFRLVVQPGMEVSLAMAVVLALDQMFGKPSLLRSWSS*

MTAKVHPNVAAPSPGLGQQPAVAPGDGEPAAVTLTVWRKSLLFNCRGFTVFDARGDLVYR
VDSYASDSRAEVVLMDAAGRPVLTVRRRCRKLIGLVGLGLSSDQWLLYRGVDEARRLPPL
YAMKRAAAQSQHMRGGAKSVAHVAACSAGAGYEVEGSYLRRRCTVYEYDGRRRAVAEVRP
SPKEAVGSDVFRLVVRPGMEVSLAMAVVLALDQMFGKPSLLRSWSS*

Other information
Ka divergence:0.37673KaKs divergence:-0.0678879
GC content 1 (%):74GC content 2 (%):72GC content divergence:-0.014
Length 1 (bp):681Length 2 (bp):681Length divergence:0
MFE 1 (kcal):-400.6MFE 2 (kcal):-373.82MFE divergence-0.035