Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G146173-GRMZM2G002948
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191733
Function (paralog2):LOC100284314

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATATAVGGPDRVETAASSAAAVLAVAVASQRLLGLLALAVQTVNVGAEIYNKDQRAIYK
LLSGRIKSENVPENKDGSDDDDDDDDDEDNDDEGGDDDDDAEEEFSGEEDGGDDDDEDDD
PEANGEEGSDNDNDDDEDGDDDDDEDDEGDEDDKDEDDDEDDEDQPPSKKKK*

MAAATAVGGHDRVEAAASSAGAVLAVAVASQRLIGLLALAVQTVNCVAEIYNEDQQEIYK
LLYGRIKSENVPEIKAGSDDDDDDEDDEDEDEDDDDDDDDDDEGGDDDDEDDDDEEGGDE
DDDPEANGEGGSDDDDDDNDGDDDGNDDDDDEDDDEDEDEEDDDDEEEQPPSKKKK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):519Length 2 (bp):531Length divergence:0.011
MFE 1 (kcal):-132.8MFE 2 (kcal):-120.7MFE divergence-0.048