Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G146240-GRMZM2G409213
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276553
Function (paralog2):hypothetical protein LOC100194246

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.29482954672343
Log2 mRNA fold difference:-0.15591097881814
Log2 TE fold difference:0.47046199188074
Sequences
Protein sequence

MGYTYTPTYYSGLQDTIASLCKSILPSFRVGRRLTADQAAARRHAEQLKWQQESFHRILH
LAALHREGIAPASDVAAFRGTMLAALVAPPQHLEQPAVLRDKLLFLQELLYAKCVSAAEY
NASKAPLVQRLAAFGVIVDCPDAEVSAEEWSEIDLRDPPPPATAAASDKPKHKAFVTPWK
SRSKKDQDVNSSASRPPLAPVDHNNATNAPVFMTESSPSETVPSGKAEKGKRRHLAGMFH
SGGSGTENKEPAGEEGVVEKETVRGKKKSSWGFDGIKKWTKAGACNSGEAAATGEQPQHV
PPRSSYSECQLEASPMAASGPDAKRAKTRLHSDTDNDSASELLRDKVLVENTKKELSRIQ
AELSSTNRNLNFSNQQMEAISTKLPVDKSDLKSYFPKAWCDQHGDGVITAAKEGFKQHVE
EMEKQRDITGSEGWATFEDIDLDDNFNPRAFSRHQPDSAFADVLETNLSSMQSASTRGRQ
RSCDVTKQVPVADTWAPVPWRCGPRRRLARSSLHDMAASVLQAERHLLLLGSGRNRPLLR
MLPPRVLFPHRRRSWPRAVRVSPGDGEGAGGFASAVEKRSIPGIVEEEGYGARGEELEGD
VAGALEQRWPPWDGLAERYKLIGATSLAFVICNMDKVNLSVAIIPMSHQYGWNSSTAGLV
QSSFFWGYALSQLPGGWLAKLFGGRKVLEVGVVTWSLATAIIPVVAGFMPGLVLSRILVG
IGEGVSPSAATDLIARSIPWQERSRAVAVVFGGLSFGSVLGLLFAPPIIQNFGWESVFYI
FGLLGIVWCLGFESLIVQRFGDKKSLLNLGQSSTGSDGLISYAMSSESSHSSLEDLQNSL
KDVPWGAFFKSKAVWAMIYAHFCGSWGHYTCLSWLPTFFSEELNLNLTEAAWVSVLPPLG
SMIITSIAAPFADNLISNGVDTTKVRKICQTIAFVSPATFMMLSSVDLGLPPWEIVAFLT
SGVALSSFALSGLYCTHQDISSEYASILLGITNTVGAVPGIVGVALTGFLLDSTHSWSIS
LFAPSIFFYLTGTVVWLAFASSKPQDFSKSGPESEP*

MGHKYTPTYYSGLQDTIASLCKSILPSFRVGRRLTSDQAAARRHAEQLKWQQESFHRILH
LAALHREGIVPAHDVAAFRGTMLAALVAPPPQHPEQPAVLRDKLLFLQELLYAKCVSAAE
YNASKAPLVRRLAAFGGGVVECPDAEASAEEWSEIDLRDPPPPAGAASSDKPKHKAFITP
WESRSRKDQDANRSASRPPLAPVDHNNANNASVLMPEYSPSEAVPCRKAEKGRRRHLAGM
FHSGGNGTENKEPAGEEGGVDEKATVKCKKKSSWGFDGIKKWKKAGACNNNGEAAATGEQ
PQRTPPRSSYSECQLEASPMAASGPDAKRAKTRLHSSTDDDCF*

Other information
Ka divergence:0.042542KaKs divergence:0.264244
GC content 1 (%):56GC content 2 (%):67GC content divergence:0.089
Length 1 (bp):3171Length 2 (bp):1032Length divergence:-0.509
MFE 1 (kcal):-1263.2MFE 2 (kcal):-479.86MFE divergence-0.449