Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G146280-GRMZM2G122607
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272812
Function (paralog2):WD-repeat domain phosphoinositide-interacting protein 3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATPASAPATPNPNPVSGDPPSLLLQQQQEEEVPAPVPETAPTPLTTSIDPTPSGGEEGE
SDDSSSVWSAPSSAPTPVLAPAPAPAAPSPAAKDILHISFNQDYGCFAAGTKSGFRIYNC
DPFREIFRRDLAAEGGVGAGGGGIGVVEMLFRCNILALVGGGDNPHYPPNKVMIWDDHQS
RCIGELSFRSPVRGVRLRRERIIVVLENKIFVYNFADLKLLHQIDTLSNPKGLCAVSQQP
GSIVLVCPGAQKGQVRVEHYKTRKTKFINAHTSRVACFALSQDGRLIATASTKGTLVRIY
NAAEGNLLQEVRRGADRAEIYSLAFSNDLQYLAVSSDKGTIHVFNLKINVGSTANDKPMP
SPDPEVPHIRPSLSFIKGVLPKYFHSEWSVAQFRLQEGEHYIVAFGHEKNTVAVVGMDGS
FYRCRFDPVNGGEMLQLDCYSFLKPSDQP*

MEPPASSPAPPNPNPVPDDRPLQQQVEEARAPEPEPERETSPTSLTTSIDPTPSGGEESE
SDDSSSVSSAPSSASAPAAAAPFPTAKDLLHISFNQDYGCFAAGTKSGFRIYNCDPFREI
FRRDLAADGGGAGGGGIGVVEMLFRCNILALVGGGDNPHYPPNKVMIWDDHQSRCIGELS
FRSPVRGVRLRRDRIIVVLENKIFVYNFADLKLVHQIETAPNPKGLCAVSQQPGSIVLVC
PGAQKGQVRVEHYGARKTKFINAHTSRVSCFALSQDGRLIATASTKGTLVRIYNAAEGNL
LQEVRRGADRAEIYSLAFSNNLQYLAVSSDKGTIHVFNLKINVGSTANDKPIPAPDPEVS
HISPPLSFIKGVLPKYFHSEWSVAQFRLHEGEQYIVAFGHEKNTVSVVGMDGSFYRCQFD
PVNGGEMLQLECYSFLKPSDQP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):58GC content divergence:0
Length 1 (bp):1350Length 2 (bp):1329Length divergence:-0.008
MFE 1 (kcal):-526.21MFE 2 (kcal):-526.27MFE divergence0