Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G146380-GRMZM5G898290
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):NAC domain protein NAC5

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.4779355454688
Log2 mRNA fold difference:1.6628780094515
Log2 TE fold difference:-0.17072145619549
Sequences
Protein sequence

MKKTLVFYTGRAPRGGKTGWVMHEYRLQGKHAAAATSSSLVVPSSVRAGASSKDEWVLCR
VFKKSIEPPSVPGSKRSSSVACMGTEGTGVGVGPSSMSTEDDFAACAALPPLMDVSGGGA
NMSLSAAAAAAAASIELTPPAAPAPHVTCFSNAPLEGQFLNPPFLLPSAAAAADHIALAA
SASPFLASMMMQQQAQYAGDAGVVHGDGLLQGAGGWYGKLAGERERLSGGGVPAEISSTR
HCMDHEASFWGF*

MEHDVHHQHQQAMELPPGFRFHPTDEELITHYLARKAADARFAPRAVGEADLNKCEPWDL
PSRATMGEKEWYFFCVKDRKYPTGLRTNRATESGYWKATGKDREIFRSKALVGMKKTLVF
YTGRAPRGGKTGWVMHEYRLHGKHASSSRLMPSSVRAGASKDEWVLCRVFKKSIEPPPSV
GKRSSVACTGTMVVEDVVGPPSMSMEDDLTACALPPLMDVSGGGGANMAAASIELLAPPA
PHVTCFSNALEGQFFLNPPCLHPSTSPLRLASMVQAQAQAQYDGDAGMVLQLLQEAGGWY
SKLGEGERLSGGASQDTGVTSEVNVNPAEISSTRHHIMDPEAASFWGF*

Other information
Ka divergence:0.0158616KaKs divergence:0.174233
GC content 1 (%):69GC content 2 (%):68GC content divergence:-0.007
Length 1 (bp):759Length 2 (bp):1047Length divergence:0.159
MFE 1 (kcal):-396.6MFE 2 (kcal):-518.12MFE divergence0.133