Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G146589-GRMZM2G386714
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273907
Function (paralog2):lysyl-tRNA synthetase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.1940628274297
Log2 mRNA fold difference:-2.9770354456747
Log2 TE fold difference:0.7924993036588
Sequences
Protein sequence

MASGLEEKLAGLSTGGDGQNPPPAGEGGEEPQLSKNAKKREEKRKKLEEERRLKEEEKKN
KAAAASGKPQKASAADDDDMDPTQYYENRLKALDSLKATGVNPYPHKFPVGISVPEYIEK
YRTLSEGEKLTDVAECLAGRIMNKRTSSSKLFFYDLYGGGMKVQVMADARTSELDEAEFS
KYHSGVKRGDIVGICGYPGKSNRGELSVFPKRFVVLSPCLHMMPRQKGEGSAVPVPWTPG
MGRNIENYVLRDQETRYRQRYLDLMVNHEVRHIFKTRSKIVSFIRKFLDDREFLEVETPM
MNMIAGGAAARPFVTHHNELNMRLFMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLT
HNPEFTTCEFYMAYADYNDLMELTETMLSGMVKDLTGGYKIKYHANGVTNPPIEIDFTPP
FRRIDMIKDLEAMANLSIPKDLSSDEANRYLIEACVKYDVKCPPPQTTSRLLDKLVGHFL
EETCVNPTFIINHPEIMSPLAKWHRSRPGLTERFELFVNKHEVCNAYTELNDPVVQRQRF
EEQLKDRQSGDDEAMALDETFCTALEYGLAPTGGWGLGIDRLTMLLTDSQNIKVRVFPLV
FYMMY*

MLMPWPWGSDGLAATTVFLSSAPPRAALKPYHSTTITPAPPQSTLTALAPSQRNLESPAR
DMADGAGSASGLVEKLAELSTGGAGQNPPPAGEGGEELQLSKNAKKREEKRKKLEEERRL
KEEEKKNKAAAAAAASGKPQKASAADDDDMDPTQYYENRLKTLDSLKAAGVNPYPHKFPV
GISVVEYIEKYKTLNNGEKLTDATECLAGRIMNKRTSSSKLFFYDLYGGGMKVQVMADAR
TSELDEAEFSKYHSSVKRGDIVGICGYPGKSNRGELSLFPKKFVVLSPCLHMMPRQKGEG
SSVPVSWTPGMGRNIENYVLRDQETRYRQRYLDIMVNHEVRHIFKTRSKVVSFIRKFLDD
REFLEVETPMMNMIAGGAAARPFITHHNELNMRLFMRIAPELYLKELVVGGLDRVYEIGK
QFRNEGIDLTHNPEFTTCEFYMAYADYNDLMELTETMLSGMVKELTGGYKIKYHANGVTN
SPIEIDFTPPFRRIDMIKDLEAMANLNIPKDLASDEANRYLIEACAKYDVKCPPPQTTSR
LLDKLVGHFLEETCVNPTFIINHPEIMSPLAKWHRSRPGLTERFELFVNKHEVCNAYTEL
NDPVVQRQRFEEQLKDRQSGDDEAMALDETFCAALEYGLPPTGGWGLGIDRLTMLLTDSQ
NIKEVLLFPAMKPQE*

Other information
Ka divergence:-0.0264607KaKs divergence:-0.0780937
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1818Length 2 (bp):2028Length divergence:0.055
MFE 1 (kcal):-576.76MFE 2 (kcal):-658.2MFE divergence0.066